DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and DMC1

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_011106.1 Gene:DMC1 / 856926 SGDID:S000000981 Length:334 Species:Saccharomyces cerevisiae


Alignment Length:295 Identity:91/295 - (30%)
Similarity:141/295 - (47%) Gaps:52/295 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VRVLKDAAAK--WLAEMPQSADSLFKPLVNVRWSRV---SFGCSALDRCTGGGVVTRGITELCGA 114
            |..:|:||.|  .:..:|.:..      :::| .||   |.|...||...|||::|..|||:.|.
Yeast    65 VEKIKEAAGKIIQVGFIPATVQ------LDIR-QRVYSLSTGSKQLDSILGGGIMTMSITEVFGE 122

  Fly   115 AGVGKTQLLLQLSLCVQLPRELGGLGKG-VAYICTESSFPARRLLQMSKACEKRHPEMELNFLGN 178
            ...||||:...|.:..|||||:|| |:| ||||.||.:|...|:.|:::..| ..||   :.|.|
Yeast   123 FRCGKTQMSHTLCVTTQLPREMGG-GEGKVAYIDTEGTFRPERIKQIAEGYE-LDPE---SCLAN 182

  Fly   179 IFVENHIEAEPLLACVINRIPRLMQQHGIGLIIIDSVAAIFRLYNDYL------ERARHMRRLAD 237
            :.....:.:|..:. ::.::...:......||::||:.|.||:  ||.      ||.:.:.:...
Yeast   183 VSYARALNSEHQME-LVEQLGEELSSGDYRLIVVDSIMANFRV--DYCGRGELSERQQKLNQHLF 244

  Fly   238 ALLSYADKYNCAVVCVNQV----------ATRDGQDEIPCLGLQWAHLGRTR--LRVSRVPKQHR 290
            .|...|:::|.||...|||          |:.||:.  |..|...||...||  ||..|      
Yeast   245 KLNRLAEEFNVAVFLTNQVQSDPGASALFASADGRK--PIGGHVLAHASATRILLRKGR------ 301

  Fly   291 MGDQLITVRKLEILYSPETPNDFAEFLITAEGVVN 325
             ||:  .|.||:  .||:.|.....::|..:|:.:
Yeast   302 -GDE--RVAKLQ--DSPDMPEKECVYVIGEKGITD 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 83/257 (32%)
Rad51_DMC1_radA 88..324 CDD:238543 83/257 (32%)
DMC1NP_011106.1 recomb_DMC1 19..332 CDD:131292 91/295 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.