DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and XRCC3

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_200554.1 Gene:XRCC3 / 835850 AraportID:AT5G57450 Length:304 Species:Arabidopsis thaliana


Alignment Length:287 Identity:91/287 - (31%)
Similarity:139/287 - (48%) Gaps:51/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RVSFGCSALDRCTGGGVVTRGITELCGAAGVGKTQLLLQLSLCVQLPRELGGLGKGVAYICTESS 151
            :::.||..||.|..||:....:||:...:|.|||||.||||||.|||...|||.....|:.:|..
plant    20 KLTTGCEILDGCLRGGISCDSLTEIVAESGCGKTQLCLQLSLCTQLPISHGGLNGSSLYLHSEFP 84

  Fly   152 FPARRLLQMSKACEKRHPEMELNFLGN----IFVENHIEAEPLLACVINRIPRL-------MQQH 205
            ||.|||.|:|....:.:|.:..|:..|    :||:|....:.|    .:.:||:       ..:.
plant    85 FPFRRLHQLSHTFHQSNPSIYANYNDNPCDHVFVQNVHSVDHL----FDIMPRIDGFVGNSKTRF 145

  Fly   206 GIGLIIIDSVAAIFR-----LYNDYLERARHMRRLADALLSYADKYNCAVVCVNQVA----TRD- 260
            .:.||::|||||:||     ..:|..:|:....:::..|...|.|::.|:|..|||.    |.| 
plant   146 PLKLIVLDSVAALFRSEFDNTPSDLKKRSSLFFKISGKLKQLASKFDLAIVITNQVTDLVETSDG 210

  Fly   261 ---------------GQDEIPCLGLQWAHLGRTRLRVSR----VPKQHRMGDQLIT-------VR 299
                           |:..:|.|||.||:...:|..:||    :.|.....|:..:       .|
plant   211 LSGLRIGNLRYLYSSGRRVVPSLGLAWANCVNSRFFISRSDGSIVKDRSEKDENCSSSVSRSAKR 275

  Fly   300 KLEILYSPETPNDFAEFLITAEGVVNV 326
            :|:|::||..|....||:||.||:..|
plant   276 RLDIVFSPYLPGSSCEFMITREGICAV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 89/282 (32%)
Rad51_DMC1_radA 88..324 CDD:238543 90/282 (32%)
XRCC3NP_200554.1 XRCC3 28..286 CDD:410899 81/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 122 1.000 Domainoid score I1850
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H36178
Inparanoid 1 1.050 122 1.000 Inparanoid score I1971
OMA 1 1.010 - - QHG58343
OrthoDB 1 1.010 - - D1341207at2759
OrthoFinder 1 1.000 - - FOG0005621
OrthoInspector 1 1.000 - - oto4167
orthoMCL 1 0.900 - - OOG6_104619
Panther 1 1.100 - - LDO PTHR46487
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5264
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.