DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and RAD51B

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_180423.3 Gene:RAD51B / 817404 AraportID:AT2G28560 Length:371 Species:Arabidopsis thaliana


Alignment Length:350 Identity:85/350 - (24%)
Similarity:140/350 - (40%) Gaps:82/350 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NVLAPEEVLTTPKVRFLDTRQQSLHTIVRKCTPDDVRVLKDAAAKWLAEMP----QSADSLF-KP 79
            |::..::.|:..:...::.....:..|             .:|..:::|..    |||.||. |.
plant    23 NIITAKDALSMTEFELMELLDVGMKEI-------------RSAISFISEATSPPCQSARSLLEKK 74

  Fly    80 LVNVRWS-RVSFGCSALDRCTGGGVVTRGITELCGAAGVGKTQLLLQLSLCVQLPRELGGLGKGV 143
            :.|...| .:......||....||:....:|||.|..|:||:|..::|:|....|...|||...|
plant    75 VENEHLSGHLPTHLKGLDDTLCGGIPFGVLTELVGPPGIGKSQFCMKLALSASFPVAYGGLDGRV 139

  Fly   144 AYICTESSFPARRLLQMSKACEKRHPE------MELNFLGNIFV------ENHIEAEPLLACVIN 196
            .||..||.|.:||:::|..   :..||      |.....|.|.|      .|..|:       |.
plant   140 IYIDVESKFSSRRVIEMGL---ESFPEVFHLKGMAQEMAGRILVLRPTSLANFTES-------IQ 194

  Fly   197 RIPRLMQQHGIGLIIIDSVAAIFRLYNDYLERARHMRRLA---DALLSYADKYNCAVVCVNQVAT 258
            .:...:.|:.:.|::|||:.|:  |..:....|:...:|.   ..|.|.|:.....:|..|||.:
plant   195 ELKNSILQNQVKLLVIDSMTAL--LSGENKPGAQRQPQLGWHISFLKSLAEFSRIPIVVTNQVRS 257

  Fly   259 RDGQDE-------------------------IPCLGLQWAHLGRTRLRVSRVPKQHRMGDQLITV 298
            :: :||                         :..||:.|||....||.:     :.:.|.::|.|
plant   258 QN-RDETSQYSFQAKVKDEFKDNTKTYDSHLVAALGINWAHAVTIRLVL-----EAKSGQRIIKV 316

  Fly   299 RKLEILYSPETPNDFAEFLITAEGV 323
            .|     ||.:|.....|.||:.|:
plant   317 AK-----SPMSPPLAFPFHITSAGI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 71/275 (26%)
Rad51_DMC1_radA 88..324 CDD:238543 72/275 (26%)
RAD51BNP_180423.3 Rad51 65..336 CDD:285604 79/293 (27%)
P-loop_NTPase 84..337 CDD:304359 72/275 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.