DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and RAD51D

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001136043.1 Gene:RAD51D / 5892 HGNCID:9823 Length:348 Species:Homo sapiens


Alignment Length:335 Identity:80/335 - (23%)
Similarity:126/335 - (37%) Gaps:62/335 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LTTPKVRFLDTRQQSLHTIVRKCTPDDVRVLKDAAAK-------WLAEMPQSADSLFKPLVNV-- 83
            ||...::.|  |...:.|:|...:.|    |::.|.|       |.|....:...|..|.|..  
Human    12 LTEEMIQLL--RSHRIKTVVDLVSAD----LEEVAQKCGLSYKTWRAHSSGNLGGLQLPQVPAGR 70

  Fly    84 RWSRV---------------------------SFGCSALDRCTGGGVVTRGITELCGAAGVGKTQ 121
            .||.|                           :...|.||:....|:.|..:||:.|..|.||||
Human    71 SWSGVRNALKKAGLGHGGTDGLSLNAFDERGTAVSTSRLDKLLDAGLYTGEVTEIVGGPGSGKTQ 135

  Fly   122 LLLQLSLCVQLPRELGGLGKGVAYICTESSFPARRLLQMSKACEKRHPEMELNFLGNIFVENHIE 186
            :.|.::..|     ..||.:.|.|:.:.....|.||||:.:| :.:..|.:...|..|.|.:..:
Human   136 VCLCMAANV-----AHGLQQNVLYVDSNGGLTASRLLQLLQA-KTQDEEEQAEALRRIQVVHAFD 194

  Fly   187 AEPLLACVINRIPRLMQQHGIG------LIIIDSVAAIFR--LYNDYLERARHMRRLADALLSYA 243
            ...:|. |:..:...:.|...|      ::::|||.|:..  |.....|....|.:||..|.:.|
Human   195 IFQMLD-VLQELRGTVAQQVTGSSGTVKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLA 258

  Fly   244 DKYNCAVVCVNQVA-TRDGQDEIPCLGLQWAHLGRTRLRVSRVPKQHRMGDQLITVRKLEILYSP 307
            .....|||..|.:. .||.....|.||..|:.:..||:.:..:......|.:    |...:..|.
Human   259 RDLGMAVVVTNHITRDRDSGRLKPALGRSWSFVPSTRILLDTIEGAGASGGR----RMACLAKSS 319

  Fly   308 ETPNDFAEFL 317
            ..|..|.|.:
Human   320 RQPTGFQEMV 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 63/267 (24%)
Rad51_DMC1_radA 88..324 CDD:238543 63/266 (24%)
RAD51DNP_001136043.1 P-loop_NTPase 109..337 CDD:304359 61/232 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.