DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and RAD51B

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001308750.1 Gene:RAD51B / 5890 HGNCID:9822 Length:425 Species:Homo sapiens


Alignment Length:359 Identity:102/359 - (28%)
Similarity:157/359 - (43%) Gaps:72/359 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DQLPKHIREIAEQVNVLAPEEVLTTPKVRFLDTR--QQSLHTIVRKCTPDDVRVLKDAAAKWLAE 68
            |:|.:|.....:....|:|.|::   ||..|..|  .:.|..:.|.|.|      |...|..: :
Human    17 DRLSRHQILTCQDFLCLSPLELM---KVTGLSYRGVHELLCMVSRACAP------KMQTAYGI-K 71

  Fly    69 MPQSADSLFKPLVNVRWSRVSFGCSALDRCTGGGVVTRGITELCGAAGVGKTQLLLQLSLCVQLP 133
            ..:|||  |.|      :.:|...||||....|||....:||:.|..|.||||..:.:|:...||
Human    72 AQRSAD--FSP------AFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLP 128

  Fly   134 RELGGLGKGVAYICTESSFPARRLLQMSKACEKRHPEMELNFLGNIFVENHIEAEPLLAC--VIN 196
            ..:|||...|.||.|||:|.|.||::::::...|:...|...|   ...:.:.....|.|  |:.
Human   129 TNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLL---LTSSKVHLYRELTCDEVLQ 190

  Fly   197 RIPRLMQQ---HGIGLIIIDSVAAIFR------LYNDYLERARHMRRLADALLSYADKYNCAVVC 252
            ||..|.::   .||.|:|:||||::.|      |..:..||.:.:.|.|.:|...|::::..|:.
Human   191 RIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVIL 255

  Fly   253 VNQVATR---------------------DGQDEIPC----LGLQWAHLGRTRLRVSRVPKQHRMG 292
            .||:.|.                     :|.....|    ||..|:|...|||.:..:..:.   
Human   256 TNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSER--- 317

  Fly   293 DQLITVRKLEILYSPETPNDFAEFLIT--AEGVV 324
                  |::.|..||..|  |..|:.|  .||:|
Human   318 ------RQILIAKSPLAP--FTSFVYTIKEEGLV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 79/273 (29%)
Rad51_DMC1_radA 88..324 CDD:238543 80/273 (29%)
RAD51BNP_001308750.1 Rad51 65..342 CDD:285604 85/299 (28%)
Rad51_DMC1_radA 83..343 CDD:238543 80/273 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1065
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.