DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and RAD51C

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_006722064.1 Gene:RAD51C / 5889 HGNCID:9820 Length:377 Species:Homo sapiens


Alignment Length:344 Identity:99/344 - (28%)
Similarity:159/344 - (46%) Gaps:59/344 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EIAEQVNVLAPEEV---LTTPKVRFLDTRQQSLHTIVRKCTPDDVRVL------KDAAAKWLAEM 69
            :.||::..:.|.|:   :...|...|:|    |..|.|:|..:..|..      |...|..|.|.
Human    33 QTAEELLEVKPSELSKEVGISKAEALET----LQIIRRECLTNKPRYAGTSESHKKCTALELLEQ 93

  Fly    70 PQSADSLFKPLVNVRWSRVSFGCSALDRCTGGGVVTRGITELCGAAGVGKTQLLLQLSLCVQLPR 134
            ..:...:           ::| |||||...||||.....||:|||.|||||||.:||::.||:|.
Human    94 EHTQGFI-----------ITF-CSALDDILGGGVPLMKTTEICGAPGVGKTQLCMQLAVDVQIPE 146

  Fly   135 ELGGLGKGVAYICTESSFPARRLLQMSKAC--------EKRHPEMELNFLGNIFVEN---HI--- 185
            ..||:.....:|.||.||...|::.::.||        ||...|.....|.:..::|   ||   
Human   147 CFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHLQLIAEKHKGEEHRKALEDFTLDNILSHIYYF 211

  Fly   186 ---EAEPLLACVINRIPRLMQQHG-IGLIIIDSVAAIFRLYNDYLE-RARHMRRLADALLSYADK 245
               :...|||.|. .:|..:.:|. :.|:|:|.:|..||...|.|. |.|.:..||..::|.|:.
Human   212 RCRDYTELLAQVY-LLPDFLSEHSKVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANN 275

  Fly   246 YNCAVVCVNQVATRDGQDE---IPCLGLQWAHLGRTRL------RVSRVPKQHRMGDQLITVRKL 301
            :..||:..||:.|:..:::   :|.||..|.|....||      :.||:...::...|    ::.
Human   276 HRLAVILTNQMTTKIDRNQALLVPALGESWGHAATIRLIFHWDRKQSRLATLYKSPSQ----KEC 336

  Fly   302 EILYSPETPNDFAEFLITA 320
            .:|:..: |..|.:.::|:
Human   337 TVLFQIK-PQGFRDTVVTS 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 83/262 (32%)
Rad51_DMC1_radA 88..324 CDD:238543 83/261 (32%)
RAD51CXP_006722064.1 HHH_5 12..57 CDD:291205 5/23 (22%)
recomb_radA 21..349 CDD:131290 98/337 (29%)
Rad51_DMC1_radA 100..348 CDD:238543 81/265 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.