DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and dmc1

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001018618.1 Gene:dmc1 / 553953 ZFINID:ZDB-GENE-060331-93 Length:342 Species:Danio rerio


Alignment Length:339 Identity:88/339 - (25%)
Similarity:148/339 - (43%) Gaps:37/339 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDQLPKHIREIAEQVNVLAPEEVLTTPKVRFLDTRQQSLHTIVRKCTPDDVRVLKDAAAKWLAEM 69
            ::.|.||...:|: :..|....:.|...:: :.||:...:  ::..:...|..:|:||.|.|...
Zfish    26 IELLQKHGINVAD-IKKLKSVGICTVKGIQ-MTTRRALCN--IKGLSEAKVDKIKEAAGKLLTCG 86

  Fly    70 PQSADSLF---KPLVNVRWSRVSFGCSALDRCTGGGVVTRGITELCGAAGVGKTQLLLQLSLCVQ 131
            .|:|....   |.:.::....:.|     |:..||||.:..|||..|....|||||...|.:..|
Zfish    87 FQTASEYCIKRKQVFHITTGSLEF-----DKLLGGGVESMAITEAFGEFRTGKTQLSHTLCVTAQ 146

  Fly   132 LPRELGGLGKGVAYICTESSFPARRLLQMSKACEKRHPEMELNFLGNIFVENHIEAEPLLACVIN 196
            ||.|.|..|..|.:|.||::|...||..::......|..:    |.|:.......:|..:..:..
Zfish   147 LPGEYGYTGGKVIFIDTENTFRPERLKDIADRFNVDHEAV----LDNVLYARAYTSEHQMELLDF 207

  Fly   197 RIPRLMQQHGI-GLIIIDSVAAIFRL----YNDYLERARHMRRLADALLSYADKYNCAVVCVNQV 256
            ...:..::.|: .|:||||:.|:||:    ..:..||.:.:.::...|...:::||.||...||:
Zfish   208 VAAKFHEEGGVFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQM 272

  Fly   257 ATRDG-------QDEIPCLGLQWAHLGRTRLRVSRVPKQHRMGDQLITVRKLEILYSPETPNDFA 314
            ....|       ..:.|..|...||...||:.:       |.|...:.:.|  |..||..|.:.|
Zfish   273 TADPGAGMTFQADPKKPIGGHILAHASTTRISL-------RKGRAELRIAK--IFDSPHMPENEA 328

  Fly   315 EFLITAEGVVNVPE 328
            .|.|||.|:.:..:
Zfish   329 TFAITAGGITDAKD 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 70/247 (28%)
Rad51_DMC1_radA 88..324 CDD:238543 71/247 (29%)
dmc1NP_001018618.1 recomb_DMC1 26..340 CDD:131292 88/335 (26%)
HHH_5 27..81 CDD:291205 12/57 (21%)
Rad51_DMC1_radA 103..337 CDD:238543 70/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.