DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and Rad51c

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_038942551.1 Gene:Rad51c / 497976 RGDID:1563765 Length:402 Species:Rattus norvegicus


Alignment Length:338 Identity:99/338 - (29%)
Similarity:147/338 - (43%) Gaps:66/338 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EIAEQVNVLAPEEVLTTPKVRFLDTRQQSLHTIVRKCTPDDVRVL------KDAAAKWLAEMPQS 72
            |::::|.: :.||.|.|            |..:.|:|..:..|..      |...|..|.|...:
  Rat    72 ELSKEVGI-SKEEALET------------LQILRRECLTNKPRCAGTSVANKKCTALELLEQEHT 123

  Fly    73 ADSLFKPLVNVRWSRVSFGCSALDRCTGGGVVTRGITELCGAAGVGKTQLLLQLSLCVQLPRELG 137
            ...:           ::| |||||...|||:.....||:||..|||||||.:||::.||:|...|
  Rat   124 QGFI-----------ITF-CSALDNILGGGIPLMKTTEVCGVPGVGKTQLCMQLAVDVQIPECFG 176

  Fly   138 GLGKGVAYICTESSFPARRLLQMSKACEKR-------HPEMEL----------NFLGNIFVENHI 185
            |:.....:|.||.||...|::.::.||.:.       |.|.|.          |.|.:|:.....
  Rat   177 GVAGEAVFIDTEGSFMVDRVVSLATACIQHLHLIAGTHTEEEQQKALKDFTLENILSHIYYFRCH 241

  Fly   186 EAEPLLACVINRIPRLMQQHG-IGLIIIDSVAAIFRL-YNDYLERARHMRRLADALLSYADKYNC 248
            :...|||.|. .:|..:..|. :.|:|||.:|..||. .:|...|.|.:..||..|:|.|:|:..
  Rat   242 DYTELLAQVY-LLPDFLSDHSKVQLVIIDGIAFPFRHDLDDLFLRTRLLNGLAQQLISLANKHRL 305

  Fly   249 AVVCVNQVATRDGQDE---IPCLGLQWAHLGRTRLRVSRVPKQHRMGDQLITVRKLEILY-SPET 309
            ||:..||:.|:..:::   :|.||..|.|....||......||           :...|| ||..
  Rat   306 AVILTNQMTTKIDKNQASLVPALGESWGHAATIRLIFHWEQKQ-----------RFATLYKSPSQ 359

  Fly   310 PNDFAEFLITAEG 322
            ......|.||.:|
  Rat   360 KESTVPFQITPQG 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 85/259 (33%)
Rad51_DMC1_radA 88..324 CDD:238543 85/258 (33%)
Rad51cXP_038942551.1 Sms 97..>166 CDD:223993 26/80 (33%)
Rad51C 145..357 CDD:410900 70/223 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.