DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and rad51c

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001006101.1 Gene:rad51c / 450081 ZFINID:ZDB-GENE-041010-204 Length:362 Species:Danio rerio


Alignment Length:278 Identity:99/278 - (35%)
Similarity:140/278 - (50%) Gaps:40/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SRVSFGCSALDRCTGGGVVTRGITELCGAAGVGKTQLLLQLSLCVQLPRELGGLGKGVAYICTES 150
            |.|:| ||.||...||||.....||:|||.|||||||.:||::.||:|...||||....||.||.
Zfish    85 SIVTF-CSGLDDAIGGGVPVGKTTEICGAPGVGKTQLCMQLAVDVQIPVFFGGLGGKALYIDTEG 148

  Fly   151 SFPARRLLQMSKAC-----------EKRHPEMELN---FLGNIFVENHIEAEPLLACVINRIPRL 201
            ||..:|:..|::|.           |::....|||   .|.|:|:....:...||| .:..:|..
Zfish   149 SFLVQRVADMAEAAVQHCTLLAEDTEQKGALEELNVEKILSNLFLVRCHDYVKLLA-EVYLLPDF 212

  Fly   202 MQQH-GIGLIIIDSVAAIFRL-YNDYLERARHMRRLADALLSYADKYNCAVVCVNQVATR--DGQ 262
            :.:| .:.|::|||:|..||. :.|..:|.|.:..||..|:..|.::..|||..||:.||  :||
Zfish   213 LSEHPEVRLVVIDSIAFPFRHDFEDLSQRTRLLNGLAQQLIQLATQHRVAVVLTNQMTTRVSNGQ 277

  Fly   263 DE-IPCLGLQWAHLGRTRLRVSRVPKQHRMGDQLITVRKLEILY-SPETPNDFAEFLITAEGVVN 325
            .: :|.||..|.|....||.:      |..|.     |:|..|| ||.......::.||.:|..:
Zfish   278 SKLVPALGESWGHAATQRLIL------HWEGQ-----RRLASLYKSPSQMEATVQYQITVQGFRD 331

  Fly   326 VP-------EPSVPSPPA 336
            .|       :||..|.|:
Zfish   332 SPDEPRPTFDPSEVSSPS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 92/255 (36%)
Rad51_DMC1_radA 88..324 CDD:238543 93/255 (36%)
rad51cNP_001006101.1 radA 3..331 CDD:235273 94/258 (36%)
Rad51_DMC1_radA 86..330 CDD:238543 93/256 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1065
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.