DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and rad51b

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_998577.1 Gene:rad51b / 406721 ZFINID:ZDB-GENE-040426-2750 Length:373 Species:Danio rerio


Alignment Length:366 Identity:104/366 - (28%)
Similarity:157/366 - (42%) Gaps:98/366 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DQLPKHIREIAEQVNVLAPEEV-----LTTPKVRFLDTRQQSLHTIVRK-CTPDDVRVLKDAAAK 64
            ::|.:|..|..:.|..:...|:     |:.|..       .:|..:|.| |.|..:..|      
Zfish    17 ERLKRHQLETCQDVLSVTQVELSRLAGLSYPAA-------LNLQRLVSKACAPAVITAL------ 68

  Fly    65 WLAEMPQSADSLFKPLVNVRWSRVSFGCS--ALDRCTGGGVVTRGITELCGAAGVGKTQLLLQLS 127
                      .|:|     |...:.|..|  ||||...||:....:||:.|.:|.|||||.:.||
Zfish    69 ----------DLWK-----RKEELCFSTSLPALDRLLHGGLPRGALTEVTGPSGCGKTQLCMMLS 118

  Fly   128 LCVQLPRELGGLGKGVAYICTESSFPARRLLQMSKACEKRHPE--------MELNFLGNIFVENH 184
            :...||:.||||..||.||.|||:|.|.||::|:   :.|.||        :|:....::|.|  
Zfish   119 VLATLPKSLGGLDSGVIYIDTESAFSAERLVEMA---QSRFPEFFSVKERLLEMAARVHLFRE-- 178

  Fly   185 IEAEPLLAC--VINRIPRLMQQ---HGIGLIIIDSVAAIFR------LYNDYLERARHMRRLADA 238
                  |.|  |:.|:.||.:.   ...||:|:||||::.|      |..:...|:..:.:.| |
Zfish   179 ------LTCQDVLKRLERLEEDIIACRAGLVILDSVASVVRKEFDTSLPGNLTHRSNFLGQEA-A 236

  Fly   239 LLSYADKYNC-AVVCVNQVATRDGQDEIPC--------------------LGLQWAHLGRTRLRV 282
            :|.|..:..| .||..||:.|..| :::.|                    ||..|:|...|||.|
Zfish   237 VLKYLSQEFCIPVVLTNQITTHVG-EKLHCPQWNQTDASFEEDSGFVTAALGNTWSHSVNTRLIV 300

  Fly   283 SRVPKQHRMGDQLITVRKLEILYSPETPNDFAEFLITAEGV 323
                 |:...::    |::.|..||..|.....:.|..||:
Zfish   301 -----QYEDSER----RQIVIAKSPVAPFAVLSYTIQKEGI 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 87/277 (31%)
Rad51_DMC1_radA 88..324 CDD:238543 88/278 (32%)
rad51bNP_998577.1 Rad51 65..332 CDD:285604 91/309 (29%)
Rad51_DMC1_radA 79..333 CDD:238543 88/276 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1065
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.