DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and rad51

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_998371.2 Gene:rad51 / 406487 ZFINID:ZDB-GENE-040426-2286 Length:340 Species:Danio rerio


Alignment Length:256 Identity:81/256 - (31%)
Similarity:117/256 - (45%) Gaps:41/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RVSFGCSALDRCTGGGVVTRGITELCGAAGVGKTQLLLQLSLCVQLPRELGGLGKGVA-YICTES 150
            ::|.|...||:...||:.|..|||:.|....|||||...|::..|||.:.|| |:|.| ||.||.
Zfish   102 QISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTLAVTCQLPIDQGG-GEGKAMYIDTEG 165

  Fly   151 SFPARRLLQMSKACEKRHPEMELNFLGNI-----FVENHIEAEPLLACVINRIPRLMQQHGIGLI 210
            :|...|||    |..:|:..:..:.|.|:     |..:|      ...::.:...:|.:....|:
Zfish   166 TFRPERLL----AVAERYGLVGSDVLDNVAYARAFNTDH------QTQLLYQASAMMTESRYALL 220

  Fly   211 IIDSVAAIFRLYNDYLERAR------HMRRLADALLSYADKYNCAVVCVNQVATR-DG------Q 262
            |:||..|::|  .||..|..      |:.|....||..||::..|||..|||..: ||      .
Zfish   221 IVDSATALYR--TDYSGRGELSARQGHLGRFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFSAD 283

  Fly   263 DEIPCLGLQWAHLGRTRLRVSRVPKQHRMGDQLITVRKLEILYSPETPNDFAEFLITAEGV 323
            .:.|..|...||...|||.:.:...:.|:         .:|..||..|...|.|.|.|:||
Zfish   284 PKKPIGGNILAHASTTRLYLRKGRGETRI---------CKIYDSPCLPEAEAMFAINADGV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 79/254 (31%)
Rad51_DMC1_radA 88..324 CDD:238543 81/255 (32%)
rad51NP_998371.2 recomb_RAD51 26..340 CDD:274048 81/256 (32%)
HHH_5 32..81 CDD:291205
Rad51_DMC1_radA 103..336 CDD:238543 81/255 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.