DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and rad51d

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_996959.2 Gene:rad51d / 404608 ZFINID:ZDB-GENE-040426-2490 Length:327 Species:Danio rerio


Alignment Length:288 Identity:81/288 - (28%)
Similarity:128/288 - (44%) Gaps:43/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VRKCTPDDVRVLKDAAAKWLAEMPQSADSLFKPLVNVRWSRV----------------------- 88
            ::....:|:|.::|..:....|:.|.....:|.||.||  ||                       
Zfish    17 IKALQTEDIRTVEDFVSWNPEELAQKCSLSYKALVAVR--RVLLAQYTAYPISGADLYEELLSST 79

  Fly    89 ---SFGCSALDRCTGGGVVTRGITELCGAAGVGKTQLLLQLSLCVQLPRELGGLGKGVAYICTES 150
               |.|..:||:....|:.|..||||.|:.|.||||:.  .|:.|.:..:   |.:.|.||.|:.
Zfish    80 AILSTGSPSLDKLLDSGLYTGEITELTGSPGSGKTQVC--FSVAVNISHQ---LKQTVVYIDTKG 139

  Fly   151 SFPARRLLQMSKACEKRHPEMELNFLGNIFVENHIEAEPLLACVINRIPRLMQQHGIG-----LI 210
            ...|.|||||.:.......| ::..|..|.|....:...||||:.|.....:|:..:|     .:
Zfish   140 GMCANRLLQMLQTKTSNEQE-QMEALQKIKVFRVFDVFSLLACLQNLRSTGLQKTSVGGGSVKAL 203

  Fly   211 IIDSVAAIFR--LYNDYLERARHMRRLADALLSYADKYNCAVVCVNQVATRDGQDEIPC-LGLQW 272
            ::|||:|:..  |.....|....:.::|..|...|..:|.||:..|.| |:||..::.. |||.|
Zfish   204 MVDSVSAVLSPILGGKQNEGMSLLMQVAGELKMIAKDFNIAVLVTNHV-TKDGNGQLKAGLGLSW 267

  Fly   273 AHLGRTRLRVSRVPKQHRMGDQLITVRK 300
            :|:.|||:.:.||..:.....:..|:.|
Zfish   268 SHVPRTRVLLQRVENEETSSLRTATLTK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 71/248 (29%)
Rad51_DMC1_radA 88..324 CDD:238543 70/247 (28%)
rad51dNP_996959.2 P-loop_NTPase 82..300 CDD:304359 69/221 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.