DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and Dmc1

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001124039.1 Gene:Dmc1 / 362960 RGDID:1307611 Length:340 Species:Rattus norvegicus


Alignment Length:345 Identity:87/345 - (25%)
Similarity:151/345 - (43%) Gaps:49/345 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDQLPKHIREIAEQVNVLAPEEVLTTPKVRFLDTRQQSLHTIVRKCTPDDVRVLKDAAAKWLAEM 69
            :|.|.||...:|: :..|....:.|...::.  |.:::|      |   :|:.|.:|..:   ::
  Rat    24 IDLLQKHGINMAD-IKKLKSVGICTIKGIQM--TTRRAL------C---NVKGLSEAKVE---KI 73

  Fly    70 PQSADSLFKP--LVNVRWS-------RVSFGCSALDRCTGGGVVTRGITELCGAAGVGKTQLLLQ 125
            .::|:.|.:|  |...::|       .::.|....|:..|||:.:..|||..|....|||||...
  Rat    74 KEAANKLIEPGFLTAFQYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHT 138

  Fly   126 LSLCVQLPRELGGLGKGVAYICTESSFPARRLLQMSKACEKRHPEMELNFLGNIFVENHIEAEPL 190
            |.:..|||...|..|..:.:|.||::|...||..::......|..:    |.|:.......:|..
  Rat   139 LCVTAQLPGADGYSGGKIIFIDTENTFRPDRLRDIADRFNVDHDAV----LDNVLYARAYTSEHQ 199

  Fly   191 LACVINRIPRLMQQHGI-GLIIIDSVAAIFRL----YNDYLERARHMRRLADALLSYADKYNCAV 250
            :..:.....:..::.|| .|:|:||:.|:||:    ..:..||.:.:.::...|...:::||.||
  Rat   200 MELLDYVAAKFHEEAGIFKLLIVDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAV 264

  Fly   251 VCVNQVATRDG-------QDEIPCLGLQWAHLGRTRLRVSRVPKQHRMGDQLITVRKLEILYSPE 308
            ...||:....|       ..:.|..|...||...||:.:       |.|...:.:.|  |..|||
  Rat   265 FVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISL-------RKGRGELRIAK--IYDSPE 320

  Fly   309 TPNDFAEFLITAEGVVNVPE 328
            .|.:.|.|.||..|:.:..|
  Rat   321 MPENEATFAITTGGIGDAKE 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 67/247 (27%)
Rad51_DMC1_radA 88..324 CDD:238543 68/247 (28%)
Dmc1NP_001124039.1 recomb_DMC1 24..338 CDD:131292 86/341 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.