DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and Rad51D

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster


Alignment Length:374 Identity:84/374 - (22%)
Similarity:131/374 - (35%) Gaps:124/374 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QVNVLAPEEVLTTPKVRFLDTRQQSLHTI----------------------VRKCTPDDVRVLKD 60
            |:|:|....:.:.  :.|.|..::.||.:                      |.:.|||   ...|
  Fly    20 QLNLLRKNNICSL--IDFYDADEKKLHELWAINIQSVRELKKELSLLPKGSVDEGTPD---FNYD 79

  Fly    61 AAAKWLAEMPQSADSLFKPLVNVRWSRVSFGCSALDRCTGGGVVTRGITELCGAAGVGKTQLLLQ 125
            ...:.|.::..|.:..|||      .||                    .||||..||||||||..
  Fly    80 TGIEELDKLLDSVEQPFKP------GRV--------------------WELCGQPGVGKTQLLYT 118

  Fly   126 LSLCVQLPRELGGLGKGVAYICTESSFPARRLLQMSKACEKRHPEMELNFLGNIFVENHIEAEPL 190
            |:|     ..:....:.|.:|.|:..|..:|:..|.:|.|......|....|...|:....|:  
  Fly   119 LAL-----NFVWKHSQAVLFIDTKREFSCKRIQDMLRAREVDEEASERAMKGIRVVQAATGAD-- 176

  Fly   191 LACVINRIPR------LMQQHG---IGLIIIDSVAAIFRLYNDYLERARHMRRLADALLSYADKY 246
                ||.:.:      ..:.|.   ..|::|||:||.|..|     |.|.||.:..::|:     
  Fly   177 ----INDLLKSFDHQLTAETHASMQTKLVLIDSLAACFAFY-----RGRRMRDVRKSVLT----- 227

  Fly   247 NCAVVC-VNQVATR-------------------------DGQDE-------IPCLGLQWAHLGRT 278
              .:.| :.::|.|                         :|.||       .|.||..|:.:...
  Fly   228 --ELACKIRKLALRGVAFVIGNVSFFENNKDSCGDDGEQNGDDEEVTRQQLEPMLGSYWSSVATL 290

  Fly   279 RLRVSRVPKQH---RMGDQLITVRKLEILYSPETPNDFAEFLITAEGVV 324
            ||.| .:|::.   ...|.|..:..:...|.|:  .:.....||..|||
  Fly   291 RLSV-ELPEEEDFTLQDDGLRFIYVISNTYGPD--GEHCLLRITDAGVV 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 64/280 (23%)
Rad51_DMC1_radA 88..324 CDD:238543 64/280 (23%)
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 70/307 (23%)
radB 80..335 CDD:236482 69/306 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468450
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.