DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and Rad51d

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001100499.1 Gene:Rad51d / 303375 RGDID:1306944 Length:329 Species:Rattus norvegicus


Alignment Length:317 Identity:83/317 - (26%)
Similarity:126/317 - (39%) Gaps:48/317 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VRVLKDAAAKWLAEMPQSADSLFKPLVNVRWSRV--------------------------SFGCS 93
            ::.:.|.||..|.|:.|.....:|.||.:|  ||                          |.|..
  Rat    25 IKTVADLAAADLEEVAQKCGLSYKALVALR--RVLLAQFSAFPLNGADLYEELKTSTAILSTGIG 87

  Fly    94 ALDRCTGGGVVTRGITELCGAAGVGKTQLLLQLSLCVQLPRELGGLGKGVAYICTESSFPARRLL 158
            :||:....|:.|..:||:.|..|.|||    |:.||| .......|.:.|.|:.:.....|.|||
  Rat    88 SLDKLLDAGLYTGELTEIVGGPGSGKT----QVCLCV-AANVAHSLQQNVLYVDSNGGMTASRLL 147

  Fly   159 QMSKACEKRHPEMELNFLGNIFVENHIEAEPLLACVINRIPRLMQQ-----HGIGLIIIDSVAAI 218
            |:.:| ..:..|.:.:.|..|.|.:..:...:|..:.:....:.||     ..:.::|:|||.|:
  Rat   148 QLLQA-RTQDEEKQASALQRIQVVHSFDIFQMLDMLQDLRGTMAQQATASSGTVKVVIVDSVTAV 211

  Fly   219 FR--LYNDYLERARHMRRLADALLSYADKYNCAVVCVNQVA-TRDGQDEIPCLGLQWAHLGRTRL 280
            ..  |.....|....|.:||..|...|.....|||..|.:. .||.:...|.||..|:.:..||:
  Rat   212 VAPLLGGQQREGLALMMQLARELKILARDLGVAVVVTNHLTRDRDSRRFKPALGRSWSFVPSTRI 276

  Fly   281 RVSRVPKQHRMGDQLITVRKLEILYSPETPNDFAEFLITAEGVVNVPEPSVPSPPAK 337
            .:........:|....|||   ::.||..|....|  :...|.:...|.| |..|.|
  Rat   277 LLEVFEGAGTLGRSQRTVR---LIKSPRQPTGLQE--VIDIGTLGTEEQS-PELPGK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 67/269 (25%)
Rad51_DMC1_radA 88..324 CDD:238543 67/269 (25%)
Rad51dNP_001100499.1 recomb_radA 10..305 CDD:131290 76/290 (26%)
Rad51_DMC1_radA 82..318 CDD:238543 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.