DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and Rad51d

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_036012348.1 Gene:Rad51d / 19364 MGIID:1261809 Length:341 Species:Mus musculus


Alignment Length:326 Identity:88/326 - (26%)
Similarity:127/326 - (38%) Gaps:55/326 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PDDVRVLK-----DAAAKWLAEMPQSADSLFKPLVNVRWSRV----------------------- 88
            |...|||:     |.||..|.|:.|.....:|.||.:|  ||                       
Mouse    29 PRAPRVLRVGKVADLAAADLEEVAQKCGLSYKALVALR--RVLLAQFSAFPLNGADLYEELKTST 91

  Fly    89 ---SFGCSALDRCTGGGVVTRGITELCGAAGVGKTQLLLQLSLCVQLPRELGGLGKGVAYICTES 150
               |.|..:||:....|:.|..:||:.|..|.|||    |:.||| .......|.:.|.|:.:..
Mouse    92 AILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKT----QVCLCV-AANVAHSLQQNVLYVDSNG 151

  Fly   151 SFPARRLLQMSKACEKRHPEMELNFLGNIFVENHIEAEPLLACVINRIPRLMQQH-----GIGLI 210
            ...|.||||:.:| ..:..|.:.:.|..|.|....:...:|..:.:....:.||.     .:.::
Mouse   152 GMTASRLLQLLQA-RTQDEEKQASALQRIQVVRSFDIFRMLDMLQDLRGTIAQQEATSSGAVKVV 215

  Fly   211 IIDSVAAIFR--LYNDYLERARHMRRLADALLSYADKYNCAVVCVNQVATR--DGQDEIPCLGLQ 271
            |:|||.|:..  |.....|....|.:||..|...|.....|||..|.: ||  ||:...|.||..
Mouse   216 IVDSVTAVVAPLLGGQQREGLALMMQLARELKILARDLGVAVVVTNHL-TRDWDGRRFKPALGRS 279

  Fly   272 WAHLGRTRLRVSRVPKQHRMGDQLITVRKLEILYSPETPNDFAEFLITAEGVVNVPEPSVPSPPA 336
            |:.:..||:.:........:|....||.   :..||..|....|.:..  |.:...|.| |..|.
Mouse   280 WSFVPSTRILLDVTEGAGTLGSSQRTVC---LTKSPRQPTGLQEMIDI--GTLGTEEQS-PELPG 338

  Fly   337 K 337
            |
Mouse   339 K 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 68/270 (25%)
Rad51_DMC1_radA 88..324 CDD:238543 68/270 (25%)
Rad51dXP_036012348.1 PRK09302 <73..>126 CDD:236461 11/52 (21%)
Rad51D 106..311 CDD:410897 58/214 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.