DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and Rad51

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_035364.1 Gene:Rad51 / 19361 MGIID:97890 Length:339 Species:Mus musculus


Alignment Length:256 Identity:79/256 - (30%)
Similarity:116/256 - (45%) Gaps:41/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RVSFGCSALDRCTGGGVVTRGITELCGAAGVGKTQLLLQLSLCVQLPRELGGLGKGVA-YICTES 150
            :::.|...||:...||:.|..|||:.|....||||:...|::..|||.:.|| |:|.| ||.||.
Mouse   101 QITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGG-GEGKAMYIDTEG 164

  Fly   151 SFPARRLLQMSKACEKRHPEMELNFLGNI-----FVENHIEAEPLLACVINRIPRLMQQHGIGLI 210
            :|...|||    |..:|:.....:.|.|:     |..:|      ...::.:...:|.:....|:
Mouse   165 TFRPERLL----AVAERYGLSGSDVLDNVAYARGFNTDH------QTQLLYQASAMMVESRYALL 219

  Fly   211 IIDSVAAIFRLYNDYLERAR------HMRRLADALLSYADKYNCAVVCVNQVATR-DG------Q 262
            |:||..|::|  .||..|..      |:.|....||..||::..|||..|||..: ||      .
Mouse   220 IVDSATALYR--TDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAAD 282

  Fly   263 DEIPCLGLQWAHLGRTRLRVSRVPKQHRMGDQLITVRKLEILYSPETPNDFAEFLITAEGV 323
            .:.|..|...||...|||.:.:...:.|:         .:|..||..|...|.|.|.|:||
Mouse   283 PKKPIGGNIIAHASTTRLYLRKGRGETRI---------CKIYDSPCLPEAEAMFAINADGV 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 77/254 (30%)
Rad51_DMC1_radA 88..324 CDD:238543 79/255 (31%)
Rad51NP_035364.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
recomb_RAD51 25..339 CDD:274048 79/256 (31%)
Interaction with PALB2. /evidence=ECO:0000250 184..257 18/80 (23%)
Nuclear export signal, masked by the interaction with BRCA2. /evidence=ECO:0000250|UniProtKB:Q06609 245..260 5/14 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.