DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and Rad51c

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_036012127.1 Gene:Rad51c / 114714 MGIID:2150020 Length:409 Species:Mus musculus


Alignment Length:274 Identity:82/274 - (29%)
Similarity:126/274 - (45%) Gaps:53/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EIAEQVNVLAPEEVLTTPKV---RFLDTRQQSLHTIV--RKCTPDDVRVLKDAAAKWLAEMPQSA 73
            |::::|.: :.||.|.|.::   ..|..:.:...|.|  .|||           |..|.|...:.
Mouse   151 ELSKEVGI-SKEEALETLQILRRECLTNKPRCAGTSVANEKCT-----------ALELLEQEHTQ 203

  Fly    74 DSLFKPLVNVRWSRVSFGCSALDRCTGGGVVTRGITELCGAAGVGKTQLLLQLSLCVQLPRELGG 138
            ..:           ::| |||||...|||:.....||:||..|||||||.:||::.||:|...||
Mouse   204 GFI-----------ITF-CSALDNILGGGIPLMKTTEVCGVPGVGKTQLCMQLAVDVQIPECFGG 256

  Fly   139 LGKGVAYICTESSFPARRLLQMSKAC------------EKRHPEMELNF-LGNIFVENHI----- 185
            :.....:|.||.||...|::.::.||            |:.|.:...:| |.||.  :||     
Mouse   257 VAGEAVFIDTEGSFMVDRVVSLATACIQHLHLIAGTHTEEEHQKALKDFTLENIL--SHIYYFRC 319

  Fly   186 -EAEPLLACVINRIPRLMQQH-GIGLIIIDSVAAIFRL-YNDYLERARHMRRLADALLSYADKYN 247
             :...|||.|. .:|..:..| .:.|:|||.:|..||. ..|...|.|.:..||..::|.|:.:.
Mouse   320 HDYTELLAQVY-LLPDFLSDHPKVQLVIIDGIAFPFRHDLEDLSLRTRLLNGLAQQMISLANNHR 383

  Fly   248 CAVVCVNQVATRDG 261
            .|:..:.||...:|
Mouse   384 LAICNIVQVTKPEG 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 67/196 (34%)
Rad51_DMC1_radA 88..324 CDD:238543 67/195 (34%)
Rad51cXP_036012127.1 radA 127..409 CDD:235273 82/274 (30%)
Rad51C 224..>393 CDD:410900 56/171 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1065
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.