DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-B and DMC1

DIOPT Version :9

Sequence 1:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_011528136.1 Gene:DMC1 / 11144 HGNCID:2927 Length:362 Species:Homo sapiens


Alignment Length:338 Identity:81/338 - (23%)
Similarity:146/338 - (43%) Gaps:52/338 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDQLPKHIREIAEQVNVLAPEEVLTTPKVRFLDTRQQSLHTIVRKCTPDDVRVLKDAAAKWLAEM 69
            :|.|.||...:|: :..|....:.|...::.  |.:::|      |   :|:.|.:|.   :.::
Human    24 IDLLQKHGINVAD-IKKLKSVGICTIKGIQM--TTRRAL------C---NVKGLSEAK---VDKI 73

  Fly    70 PQSADSLFKP--LVNVRWS-------RVSFGCSALDRCTGGGVVTRGITELCGAAGVGKTQLLLQ 125
            .::|:.|.:|  |....:|       .::.|....|:..|||:.:..|||..|....|||||...
Human    74 KEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHT 138

  Fly   126 LSLCVQLPRELGGLGKGVAYICTESSFPARRLLQMSKACEKRHPEMELNFLGNIFVENHIEAEPL 190
            |.:..|||...|..|..:.:|.||::|...||..::......|..:    |.|:.......:|..
Human   139 LCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAV----LDNVLYARAYTSEHQ 199

  Fly   191 LACVINRIPRLMQQHGI-GLIIIDSVAAIFRL----YNDYLERARHMRRLADALLSYADKYNCAV 250
            :..:.....:..::.|| .|:||||:.|:||:    ..:..||.:.:.::...|...:::||.||
Human   200 MELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAV 264

  Fly   251 VCVNQVATRDG-------QDEIPCLGLQWAHL---------GRTRLRVSRVPKQHRMGDQLITVR 299
            ...||:....|       ..:.|..|...||.         ||..||::::..:....:|..:|:
Human   265 FVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDRLSEREQKASVK 329

  Fly   300 KLEILYSPETPND 312
            .::   .||...|
Human   330 TIK---DPEEDTD 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-BNP_476740.1 Rad51 87..323 CDD:285604 63/247 (26%)
Rad51_DMC1_radA 88..324 CDD:238543 63/246 (26%)
DMC1XP_011528136.1 recomb_DMC1 24..329 CDD:131292 77/323 (24%)
HHH_5 25..79 CDD:291205 14/68 (21%)
Rad51_DMC1_radA 101..317 CDD:238543 58/219 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.