DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynE and atp5mea

DIOPT Version :9

Sequence 1:NP_001189221.1 Gene:ATPsynE / 41745 FlyBaseID:FBgn0038224 Length:81 Species:Drosophila melanogaster
Sequence 2:NP_001166108.1 Gene:atp5mea / 559659 ZFINID:ZDB-GENE-070928-12 Length:71 Species:Danio rerio


Alignment Length:72 Identity:26/72 - (36%)
Similarity:43/72 - (59%) Gaps:12/72 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PVRVSPLIKFGRWSLLLVGIAYGAAHQSRLSKKEEKLREIEAQQKAVRDAKLAEEKKRSAEAEAR 69
            ||:||||||..|||.||:|:.||       .::.:.|:.|.|:::     ::.||:|:..|.:.|
Zfish     4 PVQVSPLIKTARWSALLIGLIYG-------KQRYDYLKPIAAEER-----RIEEEEKKLREEQER 56

  Fly    70 ALAELSK 76
            ...:||:
Zfish    57 IYKQLSE 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynENP_001189221.1 ATP-synt_E 3..76 CDD:283362 25/70 (36%)
atp5meaNP_001166108.1 ATP-synt_E 2..>35 CDD:310351 17/37 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11367
eggNOG 1 0.900 - - E1_KOG4326
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I5440
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006318
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12427
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5266
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.