powered by:
Protein Alignment ATPsynE and atp5mea
DIOPT Version :9
Sequence 1: | NP_001189221.1 |
Gene: | ATPsynE / 41745 |
FlyBaseID: | FBgn0038224 |
Length: | 81 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001166108.1 |
Gene: | atp5mea / 559659 |
ZFINID: | ZDB-GENE-070928-12 |
Length: | 71 |
Species: | Danio rerio |
Alignment Length: | 72 |
Identity: | 26/72 - (36%) |
Similarity: | 43/72 - (59%) |
Gaps: | 12/72 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 PVRVSPLIKFGRWSLLLVGIAYGAAHQSRLSKKEEKLREIEAQQKAVRDAKLAEEKKRSAEAEAR 69
||:||||||..|||.||:|:.|| .::.:.|:.|.|::: ::.||:|:..|.:.|
Zfish 4 PVQVSPLIKTARWSALLIGLIYG-------KQRYDYLKPIAAEER-----RIEEEEKKLREEQER 56
Fly 70 ALAELSK 76
...:||:
Zfish 57 IYKQLSE 63
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I11367 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4326 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
55 |
1.000 |
Inparanoid score |
I5440 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006318 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR12427 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X5266 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
8 | 7.920 |
|
Return to query results.
Submit another query.