DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynE and atp5me

DIOPT Version :10

Sequence 1:NP_650356.1 Gene:ATPsynE / 41745 FlyBaseID:FBgn0038224 Length:81 Species:Drosophila melanogaster
Sequence 2:NP_001016415.1 Gene:atp5me / 549169 XenbaseID:XB-GENE-5722303 Length:71 Species:Xenopus tropicalis


Alignment Length:66 Identity:30/66 - (45%)
Similarity:40/66 - (60%) Gaps:5/66 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PVRVSPLIKFGRWSLLLVGIAYGAAHQSRLSKKEEKLREIEAQQKAVRDAKLAEEKKRSAEAEAR 69
            ||:|||||||.|:|.||||:.||......|....|:.|::||::|..|     ||.:|.|:..|.
 Frog     4 PVQVSPLIKFTRYSALLVGMIYGMKRYDYLKPIAEEERKVEAEEKRQR-----EEAERIAKEIAA 63

  Fly    70 A 70
            |
 Frog    64 A 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynENP_650356.1 ATP-synt_E 3..76 CDD:368558 30/66 (45%)
atp5meNP_001016415.1 ATP-synt_E 2..>36 CDD:368558 18/31 (58%)

Return to query results.
Submit another query.