powered by:
Protein Alignment ATPsynE and atp5me
DIOPT Version :9
Sequence 1: | NP_001189221.1 |
Gene: | ATPsynE / 41745 |
FlyBaseID: | FBgn0038224 |
Length: | 81 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001016415.1 |
Gene: | atp5me / 549169 |
XenbaseID: | XB-GENE-5722303 |
Length: | 71 |
Species: | Xenopus tropicalis |
Alignment Length: | 66 |
Identity: | 30/66 - (45%) |
Similarity: | 40/66 - (60%) |
Gaps: | 5/66 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 PVRVSPLIKFGRWSLLLVGIAYGAAHQSRLSKKEEKLREIEAQQKAVRDAKLAEEKKRSAEAEAR 69
||:|||||||.|:|.||||:.||......|....|:.|::||::|..| ||.:|.|:..|.
Frog 4 PVQVSPLIKFTRYSALLVGMIYGMKRYDYLKPIAEEERKVEAEEKRQR-----EEAERIAKEIAA 63
Fly 70 A 70
|
Frog 64 A 64
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
49 |
1.000 |
Domainoid score |
I11668 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
49 |
1.000 |
Inparanoid score |
I5279 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006318 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR12427 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R10997 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X5266 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 7.090 |
|
Return to query results.
Submit another query.