powered by:
Protein Alignment ATPsynE and ATP5ME
DIOPT Version :9
Sequence 1: | NP_001189221.1 |
Gene: | ATPsynE / 41745 |
FlyBaseID: | FBgn0038224 |
Length: | 81 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_009031.1 |
Gene: | ATP5ME / 521 |
HGNCID: | 846 |
Length: | 69 |
Species: | Homo sapiens |
Alignment Length: | 69 |
Identity: | 32/69 - (46%) |
Similarity: | 42/69 - (60%) |
Gaps: | 9/69 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 PVRVSPLIKFGRWSLLLVGIAYGAAHQSRLSKKEEKLREIEAQQKAVRDAKLAEEKKRSAEAEAR 69
||:||||||.||:|.|.:|:||||...:.|..:.|:.|.|.|::| |..:|.||. ||
Human 4 PVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEK-----KKQDELKRI----AR 59
Fly 70 ALAE 73
.|||
Human 60 ELAE 63
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
51 |
1.000 |
Domainoid score |
I11646 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4326 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
52 |
1.000 |
Inparanoid score |
I5461 |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S5948 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006318 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto90370 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR12427 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R10997 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X5266 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
11 | 10.900 |
|
Return to query results.
Submit another query.