DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynE and ATP5ME

DIOPT Version :9

Sequence 1:NP_001189221.1 Gene:ATPsynE / 41745 FlyBaseID:FBgn0038224 Length:81 Species:Drosophila melanogaster
Sequence 2:NP_009031.1 Gene:ATP5ME / 521 HGNCID:846 Length:69 Species:Homo sapiens


Alignment Length:69 Identity:32/69 - (46%)
Similarity:42/69 - (60%) Gaps:9/69 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PVRVSPLIKFGRWSLLLVGIAYGAAHQSRLSKKEEKLREIEAQQKAVRDAKLAEEKKRSAEAEAR 69
            ||:||||||.||:|.|.:|:||||...:.|..:.|:.|.|.|::|     |..:|.||.    ||
Human     4 PVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEK-----KKQDELKRI----AR 59

  Fly    70 ALAE 73
            .|||
Human    60 ELAE 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynENP_001189221.1 ATP-synt_E 3..76 CDD:283362 32/69 (46%)
ATP5MENP_009031.1 ATP-synt_E 2..69 CDD:310351 32/69 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I11646
eggNOG 1 0.900 - - E1_KOG4326
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5461
Isobase 1 0.950 - 0 Normalized mean entropy S5948
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006318
OrthoInspector 1 1.000 - - oto90370
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12427
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10997
SonicParanoid 1 1.000 - - X5266
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.