DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PR-Set7 and egg

DIOPT Version :9

Sequence 1:NP_001247100.1 Gene:PR-Set7 / 41743 FlyBaseID:FBgn0011474 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_611966.3 Gene:egg / 37962 FlyBaseID:FBgn0086908 Length:1262 Species:Drosophila melanogaster


Alignment Length:329 Identity:75/329 - (22%)
Similarity:117/329 - (35%) Gaps:69/329 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 TTTAAVAACKSRRRLNQPKPQAPYQPQLQKPPSQQQQQQQD------------DIVVVLDDDDDE 450
            |.:.|:||..|.|:      |.||..:....|.:...:.:|            .::|.:|.|...
  Fly    60 THSEAIAATGSTRK------QCPYGGKAPDEPGKLADESEDRKGENTKAIASSPVLVAVDSDSSV 118

  Fly   451 GDDEDDVRALIKAAEERENQNKAPATANSNKAGMKTMLKPAPVKSKTKSKGPTKGQPPLPLAATN 515
            ...|..|:  ..:|.|.|.....|...|...|.....:..:.:.|.|....|.|.:      .||
  Fly   119 ELIESPVK--FSSANESEKDPPKPDAVNEAAAKEAEEMTDSSISSPTSESFPEKDE------KTN 175

  Fly   516 -GNREMTDFFPVRRSVRKTKTAVKEEW-----MRG---------LEQAVLEERCDGLQVRHFMGK 565
             .|.:......|.:.|.::.:...||:     ::|         .|..:::::.|.|:|.  :.|
  Fly   176 KENEQEPPGMEVDQDVEESISRPAEEYKIENTLKGHKRISLTEIEEHKIVDKKDDVLEVE--LEK 238

  Fly   566 GRGVVADRPFKRNEFVVEYVGDLISIGE-----AAEREKRYALDENAGCYMYYFKHKS--QQY-- 621
            |....|....|.|..:.:  ||:....|     ..:..|:|.|...|....|....||  ||:  
  Fly   239 GTAPKAAEDEKLNALLSD--GDVFYDKECVNCNCTKLHKQYVLANMATLNFYQVLRKSSKQQFLC 301

  Fly   622 --CIDATVDTGKLGRLINHSRAGNLMTKVVLIKQRPH-----LVLLAKDDIEPGEELTYDYGDRS 679
              |.|..:|       :....||.||.|..|:.:..|     .|.|...| |..||...:..|.|
  Fly   302 MGCHDTAMD-------LYEEYAGQLMAKQPLLLKDFHQDHADFVALDSSD-EEEEEKQPEKSDFS 358

  Fly   680 KESL 683
            |..|
  Fly   359 KNKL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PR-Set7NP_001247100.1 SET 566..676 CDD:279228 32/125 (26%)
eggNP_611966.3 HMT_MBD 823..879 CDD:238689
Pre-SET 901..1013 CDD:282838
SET 1022..1239 CDD:214614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467607
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.