DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PR-Set7 and G9a

DIOPT Version :9

Sequence 1:NP_001247100.1 Gene:PR-Set7 / 41743 FlyBaseID:FBgn0011474 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster


Alignment Length:597 Identity:118/597 - (19%)
Similarity:206/597 - (34%) Gaps:203/597 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KAGRTIGVPLATRSQTRTIENFFKANAAAKDSQ-KTIHTEEQLNLGNQE---------------- 127
            :.|..:.:.|| ..:|....|......|:|:.: |....||:....|||                
  Fly    25 EGGTLLNLNLA-EDKTLKWRNLANNQFASKEKKHKDKEEEERKEARNQEEIEDIKALLADVVDAA 88

  Fly   128 -LKLDDEELNGQIKLDDEVLKLADKQINENLPFADEV---DAKAEQKLMDEELQQVVEELLFDGS 188
             :||::||.....|::.......:::..:.:.:..:|   |::.|:|...:.....|:   .:.:
  Fly    89 AVKLEEEEAQNAEKVEPHTKCEIEEEGRKEMEYDQDVAKQDSEMEKKQNGKATSITVK---MESN 150

  Fly   189 SRASSNSPFYQHDMDVMQEIQQTPEIPHIKKVTEPLEGLGSLADFQTHRSALRDSHSSTHSSSTD 253
            .||..::          .||..|.        ||..|......:.|..::|.::           
  Fly   151 ERAEKHA----------TEIATTS--------TERWENESFKTEQQNKKAAEKE----------- 186

  Fly   254 NIFLQEPVLT----LDIDRTPTKASSIKINRSFELAGAVFSSPPSVLNACLNGRFNQIVSLNGQK 314
                :||:|.    |:.:..|...:.|::         ..:||             .:||....|
  Fly   187 ----EEPILAATQKLEANAEPLTTTRIEV---------AVASP-------------LVVSSASVK 225

  Fly   315 EALDLPHFDLDQHDSSSCDSGVACGLTANTE-SPAGQPRRRKPATPHRILCPSPIKTALKVTGGI 378
            .|.|..:     ...::..:|.|.....|.: ||.|..|.|:        .|.||.|...||...
  Fly   226 LAADATN-----QMRAATSAGAATLADKNVQVSPGGTRRSRR--------TPRPIDTPTSVTDEH 277

  Fly   379 CKV-----GSADP---------------------LSPRKSPRKLPTTTA-------AVAACKSRR 410
            .:|     |.::.                     |..:..|.| |:.||       |.|..:.|.
  Fly   278 VQVENKKFGKSEQYTDCSSHLERFTLDDNTAIVRLQLKSEPDK-PSLTALSPEENSAPAPKRGRG 341

  Fly   411 RLNQPKPQA---------PYQPQL-QKPPSQQQ--------QQQQDDIVVVLDDDDDEGDDE-DD 456
            |..:.:|.|         |.:..| :|.|.:::        |||..|:|||..:.::.||.. .|
  Fly   342 RARKIRPDAEVETSEVILPCEDSLGEKKPGRKRKLPDEPIDQQQLSDLVVVKTEQEELGDAPLGD 406

  Fly   457 VRALIKAA-------------EERENQNKAP-ATANSNKAGMKTMLKPAPV---KSKTKSKGPTK 504
            |:.:.::.             ||.:.:...| .:|..:.|.:.:.:.|..|   |:..|.:| .|
  Fly   407 VKRMRRSVRLGNRLHADGSPWEEVKTEALHPQPSAELSFAEVTSEILPLAVLDEKTPPKKRG-RK 470

  Fly   505 GQPP-----------LPLAATNGNREMTDF------FPVRRSVRKTKTAVKEEWMRGLEQAVLEE 552
            .:.|           ||.|  |||::....      .| :||.|:.|...|          :||.
  Fly   471 AKTPCVKLESETSCGLPFA--NGNKKTNSSGGCELQLP-KRSKRRIKPTPK----------ILEN 522

  Fly   553 ---RCDGLQVRH 561
               ||: .:.:|
  Fly   523 DELRCE-FETKH 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PR-Set7NP_001247100.1 SET 566..676 CDD:279228
G9aNP_001259088.1 ATP-synt_B 150..248 CDD:304375 25/157 (16%)
Ank_2 1056..1152 CDD:289560
ANK 1088..1217 CDD:238125
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
Ank_2 1127..1249 CDD:289560
ANK 1155..1306 CDD:238125
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
Ank_2 1205..1316 CDD:289560
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
PreSET 1357..1466 CDD:128744
SET 1495..1602 CDD:214614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467632
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.