DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr2I and AT4G18720

DIOPT Version :10

Sequence 1:NP_731898.1 Gene:Polr2I / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_193607.1 Gene:AT4G18720 / 827606 AraportID:AT4G18720 Length:266 Species:Arabidopsis thaliana


Alignment Length:78 Identity:16/78 - (20%)
Similarity:29/78 - (37%) Gaps:15/78 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EADSNCIYVNKIMHEIDELTH----IVPDVISDPTLPR----TEDHACPKCSHREAV-------F 100
            :.|.|...|::.:..::.|..    :|.||:...::.:    ..||..||......:       |
plant    21 KGDENSPEVSRFVDAMNRLKEAPKSLVCDVVCKTSMGQGLEFFIDHKNPKIRSEGRILRDLWMKF 85

  Fly   101 FQAQTRRAEEEMR 113
            |.|..|....:.|
plant    86 FYASGREKSRDNR 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr2INP_731898.1 RPB9 19..129 CDD:441202 16/78 (21%)
Zn-ribbon_RPB9 78..128 CDD:259793 9/47 (19%)
AT4G18720NP_193607.1 TFSII 14..>215 CDD:273592 16/78 (21%)
TFS2M 119..224 CDD:128786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.