DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII15 and NRPB9A

DIOPT Version :9

Sequence 1:NP_001247099.1 Gene:RpII15 / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_188323.1 Gene:NRPB9A / 820954 AraportID:AT3G16980 Length:114 Species:Arabidopsis thaliana


Alignment Length:112 Identity:71/112 - (63%)
Similarity:88/112 - (78%) Gaps:1/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IRFCQECNNMLYPKEDKENKILLYACRNCDYKQEADSNCIYVNKIMHEIDELTHIVPDVISDPTL 82
            ::||:||||:||||||||.|||||||||||:::.||::|:|.|::.|.:.|.|.|:.||.|||||
plant     4 MKFCRECNNILYPKEDKEQKILLYACRNCDHQEVADNSCVYRNEVHHSVSERTQILTDVASDPTL 68

  Fly    83 PRTEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRWTE 129
            |||:...|.||.||||||||| |.|.||.|.|::||.|.||.|||.|
plant    69 PRTKAVRCSKCQHREAVFFQA-TARGEEGMTLFFVCCNPNCGHRWRE 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII15NP_001247099.1 RPB9 18..129 CDD:224510 70/110 (64%)
Zn-ribbon_RPB9 78..128 CDD:259793 33/49 (67%)
NRPB9ANP_188323.1 RPB9 3..114 CDD:224510 70/110 (64%)
Zn-ribbon_RPB9 64..113 CDD:259793 33/49 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I3510
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 162 1.000 Inparanoid score I1616
OMA 1 1.010 - - QHG55234
OrthoDB 1 1.010 - - D1421187at2759
OrthoFinder 1 1.000 - - FOG0003781
OrthoInspector 1 1.000 - - otm3356
orthoMCL 1 0.900 - - OOG6_102455
Panther 1 1.100 - - O PTHR11239
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2636
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.