DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr2I and AT2G42730

DIOPT Version :10

Sequence 1:NP_731898.1 Gene:Polr2I / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001189735.1 Gene:AT2G42730 / 818873 AraportID:AT2G42730 Length:457 Species:Arabidopsis thaliana


Alignment Length:75 Identity:13/75 - (17%)
Similarity:23/75 - (30%) Gaps:15/75 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LTHIVPDVISDPTLPRTEDHACPKCSHR------EAVFFQAQTRRAEEE---------MRLYYVC 118
            |.|.:.:...|..:....|.:...|...      |.:.:|..||...:.         :.|..:|
plant   355 LDHYITNRCGDVCVCYDTDESITSCLSSSQVKVLEILSYQGTTRELNQMKHFLEKLPCLELVKIC 419

  Fly   119 TNQNCTHRWT 128
            ...|..:..|
plant   420 VVNNSNNLQT 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr2INP_731898.1 RPB9 19..129 CDD:441202 13/75 (17%)
Zn-ribbon_RPB9 78..128 CDD:259793 10/64 (16%)
AT2G42730NP_001189735.1 F-box_AtFBL13-like 7..41 CDD:438931
leucine-rich repeat 143..164 CDD:275379
leucine-rich repeat 165..191 CDD:275379
leucine-rich repeat 192..213 CDD:275379
leucine-rich repeat 214..234 CDD:275379
leucine-rich repeat 258..294 CDD:275379
leucine-rich repeat 295..320 CDD:275379
leucine-rich repeat 321..346 CDD:275379
FBD 378..451 CDD:214730 9/52 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.