DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr2I and TFIIS

DIOPT Version :10

Sequence 1:NP_731898.1 Gene:Polr2I / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_181390.1 Gene:TFIIS / 818438 AraportID:AT2G38560 Length:378 Species:Arabidopsis thaliana


Alignment Length:43 Identity:16/43 - (37%)
Similarity:23/43 - (53%) Gaps:2/43 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 TEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRW 127
            |:...|.:|..|:..::|.|||.|:|.|..|..|.  ||.:.|
plant   335 TDQFKCGRCGQRKCTYYQMQTRSADEPMTTYVTCV--NCDNHW 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr2INP_731898.1 RPB9 19..129 CDD:441202 16/43 (37%)
Zn-ribbon_RPB9 78..128 CDD:259793 16/43 (37%)
TFIISNP_181390.1 TFSII 21..378 CDD:273592 16/43 (37%)

Return to query results.
Submit another query.