DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr2I and Med26

DIOPT Version :10

Sequence 1:NP_731898.1 Gene:Polr2I / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_081761.2 Gene:Med26 / 70625 MGIID:1917875 Length:588 Species:Mus musculus


Alignment Length:51 Identity:10/51 - (19%)
Similarity:16/51 - (31%) Gaps:10/51 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TAFDAAHTEGPGFVGIRFCQECNNMLYP----------KEDKENKILLYAC 43
            |..|....:...:.|:..|::.....|.          .:|....||.|.|
Mouse   536 TQDDLDRIQAQQWPGVNGCEDTQGNWYDWTQCISLDPHGDDGRLNILPYVC 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr2INP_731898.1 RPB9 19..129 CDD:441202 7/35 (20%)
Zn-ribbon_RPB9 78..128 CDD:259793
Med26NP_081761.2 TFS2N 12..86 CDD:197766
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..393
Med26_M 178..405 CDD:464807
Med26_C 407..586 CDD:464806 9/49 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 412..441
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.