powered by:
Protein Alignment RpII15 and TCEA2
DIOPT Version :9
Sequence 1: | NP_001247099.1 |
Gene: | RpII15 / 41741 |
FlyBaseID: | FBgn0004855 |
Length: | 129 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005260286.1 |
Gene: | TCEA2 / 6919 |
HGNCID: | 11614 |
Length: | 324 |
Species: | Homo sapiens |
Alignment Length: | 70 |
Identity: | 21/70 - (30%) |
Similarity: | 31/70 - (44%) |
Gaps: | 11/70 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 DELTHI----VPDVISDPTLPR-----TEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQN 122
|||..| ..:.|.:..:.| |:...|.||..:...:.|.|||.::|.|..:.|| ..
Human 229 DELKEIRKAMTKEAIREHQMARTGGTQTDLFTCGKCRKKNCTYTQVQTRSSDEPMTTFVVC--NE 291
Fly 123 CTHRW 127
|.:||
Human 292 CGNRW 296
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1594 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.