DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr2I and TCEA1

DIOPT Version :10

Sequence 1:NP_731898.1 Gene:Polr2I / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_006747.1 Gene:TCEA1 / 6917 HGNCID:11612 Length:301 Species:Homo sapiens


Alignment Length:128 Identity:28/128 - (21%)
Similarity:40/128 - (31%) Gaps:54/128 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RNCDYKQEADSNCIYVNKIMHEIDELT--------------HIVPDVISDPTL------------ 82
            ||.|.|        |.|::...|..|.              :|.||:.:..|.            
Human   181 RNTDMK--------YKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMR 237

  Fly    83 ------------------PRTEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRW 127
                              .:|:...|.||..:...:.|.|||.|:|.|..:.||  ..|.:||
Human   238 KNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVC--NECGNRW 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr2INP_731898.1 RPB9 19..129 CDD:441202 28/128 (22%)
Zn-ribbon_RPB9 78..128 CDD:259793 17/80 (21%)
TCEA1NP_006747.1 TFSII 4..301 CDD:273592 28/128 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..137
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.