DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII15 and Tceanc2

DIOPT Version :9

Sequence 1:NP_001247099.1 Gene:RpII15 / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_079893.1 Gene:Tceanc2 / 66526 MGIID:1913776 Length:207 Species:Mus musculus


Alignment Length:48 Identity:12/48 - (25%)
Similarity:23/48 - (47%) Gaps:4/48 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKEDKENKILLYACRNCDYKQEADSNCIYVNKIMHEIDEL-THIVPDV 76
            |.:.|||  |:.|.:... |:......:...:|.|.:::: .|..|:|
Mouse    51 PDQTKEN--LVAALQELK-KKMPSREVLRSTRIGHAVNKMRRHSDPEV 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII15NP_001247099.1 RPB9 18..129 CDD:224510 12/48 (25%)
Zn-ribbon_RPB9 78..128 CDD:259793
Tceanc2NP_079893.1 TFIIS_I 38..111 CDD:238107 12/48 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.