DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr2I and Tceanc2

DIOPT Version :10

Sequence 1:NP_731898.1 Gene:Polr2I / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_079893.1 Gene:Tceanc2 / 66526 MGIID:1913776 Length:207 Species:Mus musculus


Alignment Length:48 Identity:12/48 - (25%)
Similarity:23/48 - (47%) Gaps:4/48 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKEDKENKILLYACRNCDYKQEADSNCIYVNKIMHEIDEL-THIVPDV 76
            |.:.|||  |:.|.:... |:......:...:|.|.:::: .|..|:|
Mouse    51 PDQTKEN--LVAALQELK-KKMPSREVLRSTRIGHAVNKMRRHSDPEV 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr2INP_731898.1 RPB9 19..129 CDD:441202 12/48 (25%)
Zn-ribbon_RPB9 78..128 CDD:259793
Tceanc2NP_079893.1 TFIIS_I 38..111 CDD:238107 12/48 (25%)
TFIIS_M 126..>202 CDD:462184
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.