| Sequence 1: | NP_731898.1 | Gene: | Polr2I / 41741 | FlyBaseID: | FBgn0004855 | Length: | 129 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_079893.1 | Gene: | Tceanc2 / 66526 | MGIID: | 1913776 | Length: | 207 | Species: | Mus musculus |
| Alignment Length: | 48 | Identity: | 12/48 - (25%) |
|---|---|---|---|
| Similarity: | 23/48 - (47%) | Gaps: | 4/48 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 30 PKEDKENKILLYACRNCDYKQEADSNCIYVNKIMHEIDEL-THIVPDV 76 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Polr2I | NP_731898.1 | RPB9 | 19..129 | CDD:441202 | 12/48 (25%) |
| Zn-ribbon_RPB9 | 78..128 | CDD:259793 | |||
| Tceanc2 | NP_079893.1 | TFIIS_I | 38..111 | CDD:238107 | 12/48 (25%) |
| TFIIS_M | 126..>202 | CDD:462184 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||