DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr2I and tceanc2

DIOPT Version :10

Sequence 1:NP_731898.1 Gene:Polr2I / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:XP_073776097.1 Gene:tceanc2 / 567698 ZFINID:ZDB-GENE-070705-486 Length:248 Species:Danio rerio


Alignment Length:40 Identity:10/40 - (25%)
Similarity:19/40 - (47%) Gaps:3/40 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKEDKENKILLYACRNCDYKQEADSNCIYVNKIMHEIDEL 69
            |.:.|||  ::.|.:..| |:......:...:|.|.::.|
Zfish    51 PGQPKEN--MIEALKELD-KKVPSREVLKSTRIGHTVNNL 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr2INP_731898.1 RPB9 19..129 CDD:441202 10/40 (25%)
Zn-ribbon_RPB9 78..128 CDD:259793
tceanc2XP_073776097.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.