DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII15 and polr3k

DIOPT Version :9

Sequence 1:NP_001247099.1 Gene:RpII15 / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001016313.1 Gene:polr3k / 548520 XenbaseID:XB-GENE-5913354 Length:108 Species:Xenopus tropicalis


Alignment Length:120 Identity:38/120 - (31%)
Similarity:50/120 - (41%) Gaps:25/120 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FCQECNNMLYPKEDKENKILLYACRNCDYKQEADSNCIYVNKI-------MHEIDELTHIVPDVI 77
            ||..|.|:|..:|.:  |...:||..|.|....:      .|:       :.|:|       ||:
 Frog     4 FCPTCGNVLIVEEGQ--KCYRFACNTCPYVHNVN------RKVTSRKYPKLKEVD-------DVL 53

  Fly    78 SDPTLPRTED---HACPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRWTE 129
            .........|   ..||||.|..|.|.|.|||.|:|.|..:|.|.|..|.|||.:
 Frog    54 GGSAAWENVDSTAETCPKCEHPRAYFMQIQTRSADEPMTTFYKCCNIQCGHRWRD 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII15NP_001247099.1 RPB9 18..129 CDD:224510 38/118 (32%)
Zn-ribbon_RPB9 78..128 CDD:259793 21/52 (40%)
polr3kNP_001016313.1 RPB9 1..108 CDD:224510 38/118 (32%)
Zn-ribbon_RPC11 61..108 CDD:259794 22/46 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D579891at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.