DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr2I and POLR3K

DIOPT Version :10

Sequence 1:NP_731898.1 Gene:Polr2I / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_057394.3 Gene:POLR3K / 51728 HGNCID:14121 Length:108 Species:Homo sapiens


Alignment Length:110 Identity:34/110 - (30%)
Similarity:51/110 - (46%) Gaps:5/110 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FCQECNNMLYPKEDKENKILLYACRNCDYKQEADSNCIYVNKIMHEIDELTHIVPDVISDPTLPR 84
            ||..|.|.|..:|.:  :...:||..|.|.......  ..|:...::.|:..::....:...:..
Human     4 FCPGCGNGLIVEEGQ--RCHRFACNTCPYVHNITRK--VTNRKYPKLKEVDDVLGGAAAWENVDS 64

  Fly    85 TEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRWTE 129
            |.: :||||.|..|.|.|.|||.|:|.|..:|.|.|..|.|||.:
Human    65 TAE-SCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD 108

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Polr2INP_731898.1 RPB9 19..129 CDD:441202 34/108 (31%)
Zn-ribbon_RPB9 78..128 CDD:259793 21/49 (43%)
POLR3KNP_057394.3 RPB9 4..107 CDD:441202 33/107 (31%)
Zn-ribbon_RPC11 61..108 CDD:259794 22/47 (47%)