DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII15 and polr2i

DIOPT Version :9

Sequence 1:NP_001247099.1 Gene:RpII15 / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001006013.2 Gene:polr2i / 449992 ZFINID:ZDB-GENE-041010-106 Length:126 Species:Danio rerio


Alignment Length:117 Identity:92/117 - (78%)
Similarity:104/117 - (88%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PGFVGIRFCQECNNMLYPKEDKENKILLYACRNCDYKQEADSNCIYVNKIMHEIDELTHIVPDVI 77
            ||||||||||||||||||||||||:|||||||||||:||||::|||||||.||:||||.|:.||.
Zfish    10 PGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVA 74

  Fly    78 SDPTLPRTEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRWTE 129
            .||||||||||.||||.|:||||||:.:.:||:.||||||||..:|.|||||
Zfish    75 QDPTLPRTEDHPCPKCGHKEAVFFQSHSMKAEDAMRLYYVCTAPHCGHRWTE 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII15NP_001247099.1 RPB9 18..129 CDD:224510 85/110 (77%)
Zn-ribbon_RPB9 78..128 CDD:259793 34/49 (69%)
polr2iNP_001006013.2 RPB9 15..126 CDD:224510 85/110 (77%)
Zn-ribbon_RPB9 75..125 CDD:259793 34/49 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579641
Domainoid 1 1.000 81 1.000 Domainoid score I8487
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4541
Inparanoid 1 1.050 213 1.000 Inparanoid score I3612
OMA 1 1.010 - - QHG55234
OrthoDB 1 1.010 - - D1421187at2759
OrthoFinder 1 1.000 - - FOG0003781
OrthoInspector 1 1.000 - - oto38920
orthoMCL 1 0.900 - - OOG6_102455
Panther 1 1.100 - - LDO PTHR11239
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4217
SonicParanoid 1 1.000 - - X2636
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.