DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr2I and tcea2

DIOPT Version :10

Sequence 1:NP_731898.1 Gene:Polr2I / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_957280.2 Gene:tcea2 / 393961 ZFINID:ZDB-GENE-040426-985 Length:301 Species:Danio rerio


Alignment Length:43 Identity:15/43 - (34%)
Similarity:22/43 - (51%) Gaps:2/43 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 TEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRW 127
            |:...|.||..:...:.|.|||.|:|.|..:.:|  ..|.:||
Zfish   258 TDMFVCGKCKGKNCTYTQVQTRSADEPMTTFVLC--NECGNRW 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr2INP_731898.1 RPB9 19..129 CDD:441202 15/43 (35%)
Zn-ribbon_RPB9 78..128 CDD:259793 15/43 (35%)
tcea2NP_957280.2 TFSII 6..301 CDD:273592 15/43 (35%)

Return to query results.
Submit another query.