DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII15 and CG33785

DIOPT Version :9

Sequence 1:NP_001247099.1 Gene:RpII15 / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001027443.1 Gene:CG33785 / 3772344 FlyBaseID:FBgn0061362 Length:108 Species:Drosophila melanogaster


Alignment Length:118 Identity:37/118 - (31%)
Similarity:53/118 - (44%) Gaps:21/118 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FCQECNNMLYPKEDKENKILLYACRNCDYKQEADSNCIYVNKIMHEID--------ELTHIVPDV 76
            ||..|.|:|..:||          .||  .:...:.|.|::||..:|.        |:.|::...
  Fly     4 FCPSCGNILIIEED----------TNC--HRFTCNTCPYISKIRRKISTKTFPRLKEVDHVLGGK 56

  Fly    77 ISDPTLPRTEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRWTE 129
            .:...:..| |..||.|.|:.|.|.|.|||.|:|.|..:|.|.|..|.|.|.:
  Fly    57 AAWENVDST-DAECPTCGHKRAYFMQIQTRSADEPMTTFYKCCNHECNHTWRD 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII15NP_001247099.1 RPB9 18..129 CDD:224510 37/116 (32%)
Zn-ribbon_RPB9 78..128 CDD:259793 20/49 (41%)
CG33785NP_001027443.1 RPB9 1..108 CDD:224510 37/116 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442318
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11239
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.