DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII15 and Polr3k

DIOPT Version :9

Sequence 1:NP_001247099.1 Gene:RpII15 / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001014281.1 Gene:Polr3k / 366277 RGDID:1587294 Length:108 Species:Rattus norvegicus


Alignment Length:110 Identity:34/110 - (30%)
Similarity:50/110 - (45%) Gaps:5/110 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FCQECNNMLYPKEDKENKILLYACRNCDYKQEADSNCIYVNKIMHEIDELTHIVPDVISDPTLPR 84
            ||..|.|.|..:|.:  :...:||..|.|.......  ..|:...::.|:..::....:...:..
  Rat     4 FCPGCGNGLIVEEGQ--RCHRFACNTCPYVHNITRK--VTNRKYPKLKEVDDVLGGAAAWENVDS 64

  Fly    85 TEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRWTE 129
            |.: .||||.|..|.|.|.|||.|:|.|..:|.|.|..|.|||.:
  Rat    65 TAE-PCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII15NP_001247099.1 RPB9 18..129 CDD:224510 34/108 (31%)
Zn-ribbon_RPB9 78..128 CDD:259793 21/49 (43%)
Polr3kNP_001014281.1 RPB9 1..108 CDD:224510 34/108 (31%)
Zn-ribbon_RPC11 61..108 CDD:259794 22/47 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D579891at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.