powered by:
Protein Alignment RpII15 and CG8117
DIOPT Version :9
Sequence 1: | NP_001247099.1 |
Gene: | RpII15 / 41741 |
FlyBaseID: | FBgn0004855 |
Length: | 129 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_573049.2 |
Gene: | CG8117 / 32499 |
FlyBaseID: | FBgn0030663 |
Length: | 162 |
Species: | Drosophila melanogaster |
Alignment Length: | 44 |
Identity: | 11/44 - (25%) |
Similarity: | 19/44 - (43%) |
Gaps: | 4/44 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 RTEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRW 127
:|:...|.:|..|.. .|...|..:|.:..:.:| ..|.:||
Fly 121 KTDQFKCERCDKRNC--SQLHIRDGDEPIITFVIC--DECGNRW 160
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1594 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.