powered by:
Protein Alignment RpII15 and Tcea2
DIOPT Version :9
Sequence 1: | NP_001247099.1 |
Gene: | RpII15 / 41741 |
FlyBaseID: | FBgn0004855 |
Length: | 129 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_033352.1 |
Gene: | Tcea2 / 21400 |
MGIID: | 107368 |
Length: | 299 |
Species: | Mus musculus |
Alignment Length: | 137 |
Identity: | 29/137 - (21%) |
Similarity: | 42/137 - (30%) |
Gaps: | 56/137 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 NCDYKQEADSNCI----------YVNKIMHEI--------------------------------- 66
||::.......|| |.|::...|
Mouse 162 NCEHLSSQIEECIFLDVGNTDMKYKNRVRSRISNLKDAKNPGLRRNVLCGAITPQQIAVMTSEEM 226
Fly 67 --DELTHI----VPDVISDPTLPR-----TEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTN 120
|||..| ..:.|.:..:.| |:...|.||..:...:.|.|||.::|.|..|.||
Mouse 227 ASDELKEIRKAMTKEAIREHQMARTGGTQTDLFTCNKCRKKNCTYTQVQTRSSDEPMTTYVVC-- 289
Fly 121 QNCTHRW 127
..|.:||
Mouse 290 NECGNRW 296
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1594 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.