DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII15 and Tcea2

DIOPT Version :9

Sequence 1:NP_001247099.1 Gene:RpII15 / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_033352.1 Gene:Tcea2 / 21400 MGIID:107368 Length:299 Species:Mus musculus


Alignment Length:137 Identity:29/137 - (21%)
Similarity:42/137 - (30%) Gaps:56/137 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NCDYKQEADSNCI----------YVNKIMHEI--------------------------------- 66
            ||::.......||          |.|::...|                                 
Mouse   162 NCEHLSSQIEECIFLDVGNTDMKYKNRVRSRISNLKDAKNPGLRRNVLCGAITPQQIAVMTSEEM 226

  Fly    67 --DELTHI----VPDVISDPTLPR-----TEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTN 120
              |||..|    ..:.|.:..:.|     |:...|.||..:...:.|.|||.::|.|..|.||  
Mouse   227 ASDELKEIRKAMTKEAIREHQMARTGGTQTDLFTCNKCRKKNCTYTQVQTRSSDEPMTTYVVC-- 289

  Fly   121 QNCTHRW 127
            ..|.:||
Mouse   290 NECGNRW 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII15NP_001247099.1 RPB9 18..129 CDD:224510 29/137 (21%)
Zn-ribbon_RPB9 78..128 CDD:259793 17/55 (31%)
Tcea2NP_033352.1 TFIIS_I 4..80 CDD:238107
TFSII 5..299 CDD:273592 29/137 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..127
DUF4584 87..>148 CDD:291876
TFIIS_M 136..243 CDD:284835 11/80 (14%)
Zn-ribbon_TFIIS 252..298 CDD:259796 16/47 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.