DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII15 and rpb-9

DIOPT Version :9

Sequence 1:NP_001247099.1 Gene:RpII15 / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_505062.1 Gene:rpb-9 / 179178 WormBaseID:WBGene00022400 Length:167 Species:Caenorhabditis elegans


Alignment Length:118 Identity:82/118 - (69%)
Similarity:104/118 - (88%) Gaps:0/118 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GPGFVGIRFCQECNNMLYPKEDKENKILLYACRNCDYKQEADSNCIYVNKIMHEIDELTHIVPDV 76
            |||||||:||.||||||||:||||:::|:|:||||::::.|.:.||||||::|||||||.||.|:
 Worm    50 GPGFVGIKFCPECNNMLYPREDKESRVLMYSCRNCEHREVAANPCIYVNKLVHEIDELTQIVGDI 114

  Fly    77 ISDPTLPRTEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRWTE 129
            |.|||||:||:|.||.|...:||||||||::|||||||||||.:|:|.|||||
 Worm   115 IHDPTLPKTEEHQCPVCGKSKAVFFQAQTKKAEEEMRLYYVCASQDCQHRWTE 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII15NP_001247099.1 RPB9 18..129 CDD:224510 74/110 (67%)
Zn-ribbon_RPB9 78..128 CDD:259793 34/49 (69%)
rpb-9NP_505062.1 RPB9 56..167 CDD:224510 74/110 (67%)
Zn-ribbon_RPB9 116..166 CDD:259793 34/49 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158841
Domainoid 1 1.000 70 1.000 Domainoid score I6238
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4541
Inparanoid 1 1.050 197 1.000 Inparanoid score I2504
Isobase 1 0.950 - 0 Normalized mean entropy S446
OMA 1 1.010 - - QHG55234
OrthoDB 1 1.010 - - D1421187at2759
OrthoFinder 1 1.000 - - FOG0003781
OrthoInspector 1 1.000 - - oto18606
orthoMCL 1 0.900 - - OOG6_102455
Panther 1 1.100 - - LDO PTHR11239
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4217
SonicParanoid 1 1.000 - - X2636
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1817.750

Return to query results.
Submit another query.