DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr2I and rpc-11

DIOPT Version :10

Sequence 1:NP_731898.1 Gene:Polr2I / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_500076.1 Gene:rpc-11 / 176950 WormBaseID:WBGene00022309 Length:108 Species:Caenorhabditis elegans


Alignment Length:115 Identity:33/115 - (28%)
Similarity:50/115 - (43%) Gaps:11/115 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IRFCQECNNMLYPKEDKENKILLYACRNCDYKQEADSNCIYVNKIMHEIDELTHIVPDVISDP-- 80
            :.||.||..:|  :.:...:.:.::|..|.|.      |.....:...|......:.||:..|  
 Worm     2 LTFCPECGCVL--QIESGEQCMRFSCPACPYV------CPVTQTVTSRIYPKLKDIDDVLGGPGA 58

  Fly    81 -TLPRTEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRWTE 129
             ...:..|..||.|||..|.|.|.|||.|:|...::|.|.:..|.|||.:
 Worm    59 WANAQVTDETCPVCSHGRAYFMQLQTRSADEPSTIFYRCADNACAHRWKD 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr2INP_731898.1 RPB9 19..129 CDD:441202 33/112 (29%)
Zn-ribbon_RPB9 78..128 CDD:259793 20/52 (38%)
rpc-11NP_500076.1 RPB9 4..106 CDD:441202 31/109 (28%)
Zn-ribbon_RPC11 61..108 CDD:259794 20/46 (43%)

Return to query results.
Submit another query.