powered by:
Protein Alignment RpII15 and T24H10.1
DIOPT Version :9
Sequence 1: | NP_001247099.1 |
Gene: | RpII15 / 41741 |
FlyBaseID: | FBgn0004855 |
Length: | 129 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_495941.1 |
Gene: | T24H10.1 / 174450 |
WormBaseID: | WBGene00012000 |
Length: | 308 |
Species: | Caenorhabditis elegans |
Alignment Length: | 38 |
Identity: | 13/38 - (34%) |
Similarity: | 19/38 - (50%) |
Gaps: | 2/38 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 CPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRW 127
|.||..:...:.|.|||.::|.|..:..|. .|.:||
Worm 270 CGKCGKKNCTYTQLQTRSSDEPMTTFVFCL--ECGNRW 305
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1594 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.