DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr2I and TCEANC

DIOPT Version :10

Sequence 1:NP_731898.1 Gene:Polr2I / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_689847.2 Gene:TCEANC / 170082 HGNCID:28277 Length:381 Species:Homo sapiens


Alignment Length:109 Identity:28/109 - (25%)
Similarity:43/109 - (39%) Gaps:26/109 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKEDKENKILLYACRNCDYKQEADSNCIYVNKIMHEIDELTHIVPDVISDPTLPRTEDHACPKCS 94
            |:|..|..::..|  |.:.||...|   |....:.|     |.:|.|| |.|  :|....|.:|.
Human   280 PREFAEMTVMEMA--NKELKQLRAS---YTESCIQE-----HYLPQVI-DGT--QTNKIKCRRCE 331

  Fly    95 ---------HREAVFFQAQTRRA--EEEMRLYYVCTNQNCTHRW 127
                     .|..:|..:..|.:  :|:|..|.:|  ..|..:|
Human   332 KYNCKVTVIDRGTLFLPSWVRNSNPDEQMMTYVIC--NECGEQW 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr2INP_731898.1 RPB9 19..129 CDD:441202 28/109 (26%)
Zn-ribbon_RPB9 78..128 CDD:259793 14/61 (23%)
TCEANCNP_689847.2 TFSII 36..373 CDD:273592 27/107 (25%)
TFIIS_M 202..311 CDD:462184 10/40 (25%)

Return to query results.
Submit another query.