DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII15 and polr2i

DIOPT Version :9

Sequence 1:NP_001247099.1 Gene:RpII15 / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster
Sequence 2:XP_002932661.1 Gene:polr2i / 100101756 XenbaseID:XB-GENE-922120 Length:125 Species:Xenopus tropicalis


Alignment Length:117 Identity:93/117 - (79%)
Similarity:103/117 - (88%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PGFVGIRFCQECNNMLYPKEDKENKILLYACRNCDYKQEADSNCIYVNKIMHEIDELTHIVPDVI 77
            ||||||||||||||||||||||||:|||||||||||:||||::|||||||.|||||||.|:.||.
 Frog     9 PGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEIDELTQIIADVA 73

  Fly    78 SDPTLPRTEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRWTE 129
            .||||||||||.|.||.|:||||||:.:.|||:.||||||||..:|.|||||
 Frog    74 QDPTLPRTEDHPCSKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII15NP_001247099.1 RPB9 18..129 CDD:224510 86/110 (78%)
Zn-ribbon_RPB9 78..128 CDD:259793 34/49 (69%)
polr2iXP_002932661.1 RPB9 14..125 CDD:224510 86/110 (78%)
Zn-ribbon_RPB9 74..124 CDD:259793 34/49 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8435
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4541
Inparanoid 1 1.050 181 1.000 Inparanoid score I3874
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1421187at2759
OrthoFinder 1 1.000 - - FOG0003781
OrthoInspector 1 1.000 - - oto102179
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2636
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.