DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(Hw) and STP3

DIOPT Version :9

Sequence 1:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_013479.3 Gene:STP3 / 851089 SGDID:S000004367 Length:343 Species:Saccharomyces cerevisiae


Alignment Length:255 Identity:55/255 - (21%)
Similarity:86/255 - (33%) Gaps:90/255 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 VKKP--EYMCHTCKNCFYSLSTLNIHIRTH-TGEKPFDCDLCDKKFSALVALKKHRRYHTGEKPY 469
            :.||  :..|..|:|.:.:|:|   |..|| |.|                           ::|:
Yeast   135 INKPRKKKQCPICRNFYANLTT---HKATHLTPE---------------------------DRPH 169

  Fly   470 SCTVCNQAFAVKEVLNRHMKRH--------TGERPHKCDECGKSFIQATQLRTHSKTHIRPFPCE 526
            .|.:|::.||....|.||.|||        :|...:..|..|.| :......||.|  :.|.   
Yeast   170 KCPICHRGFARNNDLLRHKKRHWKDEILSQSGVLSNHNDGKGGS-VSPNDDDTHEK--MTPM--- 228

  Fly   527 QCDEKFKTEKQLERHVKTHSRTKRPVFSCAECKRNFRTP---ALLKEHMDEGKHSPKQQRSSMRS 588
                         ..|..:::.|    |..:.|..|:.|   .|::..||...:..|...     
Yeast   229 -------------NSVTDYAQLK----SLHQIKGTFKCPFNSTLIQLDMDMYPYKLKPLN----- 271

  Fly   589 AVKIMERTDCAICDKNFDSSDTLRRHIRTVHECDPDDIFGVEPHPSKRAKKDIESEEVVP 648
                .|.::|..... |...||.:.|::.:|          ..:|....|||   ..|||
Yeast   272 ----FETSNCHQTGV-FSRCDTFKNHLKALH----------FEYPPGTKKKD---RNVVP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368
COG5048 <312..517 CDD:227381 29/119 (24%)
C2H2 Zn finger 321..341 CDD:275368
zf-C2H2 348..368 CDD:278523
C2H2 Zn finger 350..368 CDD:275368
C2H2 Zn finger 382..402 CDD:275368
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
zf-H2C2_2 428..451 CDD:290200 5/23 (22%)
C2H2 Zn finger 443..463 CDD:275368 0/19 (0%)
zf-H2C2_2 455..479 CDD:290200 3/23 (13%)
COG5048 <467..620 CDD:227381 35/163 (21%)
C2H2 Zn finger 471..491 CDD:275368 8/19 (42%)
zf-H2C2_2 484..508 CDD:290200 10/31 (32%)
C2H2 Zn finger 499..519 CDD:275368 6/19 (32%)
C2H2 Zn finger 525..545 CDD:275368 1/19 (5%)
C2H2 Zn finger 555..572 CDD:275368 4/19 (21%)
C2H2 Zn finger 598..615 CDD:275371 4/16 (25%)
STP3NP_013479.3 COG5048 <137..295 CDD:227381 47/220 (21%)
C2H2 Zn finger 144..161 CDD:275368 6/19 (32%)
C2H2 Zn finger 171..191 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.