DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(Hw) and AT3G29340

DIOPT Version :9

Sequence 1:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_189580.1 Gene:AT3G29340 / 822592 AraportID:AT3G29340 Length:650 Species:Arabidopsis thaliana


Alignment Length:489 Identity:107/489 - (21%)
Similarity:147/489 - (30%) Gaps:203/489 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 SDFPCSICNANLRSEALLALHEEQHKSRGKPYACKICGKDFTRSYH-----LKRHQKYSSCSSNE 376
            |...|.||..:......|..|:..|    :|...|:..::|:..|.     .||.:..|||    
plant    41 SSHKCKICGKSFECYQALGGHQRIH----RPIKEKLSKQEFSEVYPRKSKLQKRPESSSSC---- 97

  Fly   377 TDTMSCKVCDRVFYRLDNLRSHLKQHLGT--------------------QVVKKPEYM------- 414
               ..||||.::|.....|..|.|.|..|                    ::|.:|...       
plant    98 ---YECKVCGKIFGCYRGLGGHTKLHRSTKRELASTQDENSLLDSSEAKKIVSQPSSFKVSQEEK 159

  Fly   415 ---CHTCKNCFYS--------LSTLNIHIRTHTGEK-PFDCDLCDKKFSALVALKKHRRYH---T 464
               |...|..|..        .|||...::|.|..| ...|.:|.|.|.....|..|:|.|   :
plant   160 FLHCVELKQDFSEPLSHSGALPSTLRSKLQTKTQWKSSCHCKICGKSFVCSQGLGNHKRVHREIS 224

  Fly   465 G-------------------------EKPYSCTV------------------------------C 474
            |                         :||.|..|                              |
plant   225 GKLACKRKYTEDYNPFSDSLKAKKIVKKPSSFEVSQEEKILHCVELKQDFGELLAHSGFDKSISC 289

  Fly   475 NQAFAVKEVLNRHMKRH---------TGE---RPHKCDECGKSF-----IQATQLRTHSKTHIRP 522
            :::..||:|..::.|..         .||   |.|.|..||:.|     :...| |.||..|   
plant   290 SKSIKVKKVARKNEKTEDSTSLFGVFVGEMSQRLHGCKTCGRKFGTLKGVYGHQ-RMHSGNH--- 350

  Fly   523 FPCEQCDEKFKTEKQLER-----------HVKTHSRTKRPVFSCAECKRNFRTPALLK------- 569
                   .:.:.|..|||           .|....|.|...| .||.:::....|.|.       
plant   351 -------NRIEDENGLERIWGLKKKSRVCSVSAFDRFKGSSF-MAEIEKHEVIEAALNLVMLCQG 407

  Fly   570 --------------EHMD-EGKHSP---KQQRSSMRSAVKIMERTDCAICDKNFDSSDTLRRHIR 616
                          ..|| |.|..|   |.|:.| ||:.|      |:||:|:|..|..|..|.|
plant   408 VYDFASISNLPLGDGFMDLELKPCPLRRKLQKKS-RSSYK------CSICEKSFVCSQALGSHQR 465

  Fly   617 TVHECDPDDIFGVEPHP-----------SKRAKK 639
             :|.      :.:.|.|           |..|||
plant   466 -LHR------WKLVPKPEYIEDDSSLLDSSEAKK 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368
COG5048 <312..517 CDD:227381 66/318 (21%)
C2H2 Zn finger 321..341 CDD:275368 5/19 (26%)
zf-C2H2 348..368 CDD:278523 5/24 (21%)
C2H2 Zn finger 350..368 CDD:275368 5/22 (23%)
C2H2 Zn finger 382..402 CDD:275368 8/19 (42%)
C2H2 Zn finger 415..435 CDD:275368 6/27 (22%)
zf-H2C2_2 428..451 CDD:290200 7/23 (30%)
C2H2 Zn finger 443..463 CDD:275368 7/19 (37%)
zf-H2C2_2 455..479 CDD:290200 10/81 (12%)
COG5048 <467..620 CDD:227381 54/235 (23%)
C2H2 Zn finger 471..491 CDD:275368 6/49 (12%)
zf-H2C2_2 484..508 CDD:290200 9/40 (23%)
C2H2 Zn finger 499..519 CDD:275368 8/24 (33%)
C2H2 Zn finger 525..545 CDD:275368 5/30 (17%)
C2H2 Zn finger 555..572 CDD:275368 4/37 (11%)
C2H2 Zn finger 598..615 CDD:275371 7/16 (44%)
AT3G29340NP_189580.1 zf-C2H2_6 43..68 CDD:290623 6/28 (21%)
C2H2 Zn finger 45..65 CDD:275368 5/19 (26%)
C2H2 Zn finger 100..120 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.