| Sequence 1: | NP_001247098.1 | Gene: | su(Hw) / 41740 | FlyBaseID: | FBgn0003567 | Length: | 941 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001073432.1 | Gene: | vezf1b / 556915 | ZFINID: | ZDB-GENE-060825-121 | Length: | 460 | Species: | Danio rerio |
| Alignment Length: | 256 | Identity: | 76/256 - (29%) |
|---|---|---|---|
| Similarity: | 109/256 - (42%) | Gaps: | 51/256 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 338 EEQHKSRGKPYACKICGKDFTRSYHLKRHQKYSSCSS--------NETDTMSCKVCDRVFYRLDN 394
Fly 395 --------------------------LRSHLKQHLGTQVVKKP------EYMCHTCKNCFYSLST 427
Fly 428 LNIHIRTHTGEKPFDCDLCDKKFSALVALKKHRRYHTG--EKPYSCTVCNQAFAVKEVLNRHMKR 490
Fly 491 -HTGERPHKCD--ECGKSFIQATQLRTHSKTHIRPFPCEQCDEKFKTEKQLERHVKTHSRT 548 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| su(Hw) | NP_001247098.1 | C2H2 Zn finger | 292..313 | CDD:275368 | |
| COG5048 | <312..517 | CDD:227381 | 67/223 (30%) | ||
| C2H2 Zn finger | 321..341 | CDD:275368 | 0/2 (0%) | ||
| zf-C2H2 | 348..368 | CDD:278523 | 10/19 (53%) | ||
| C2H2 Zn finger | 350..368 | CDD:275368 | 10/17 (59%) | ||
| C2H2 Zn finger | 382..402 | CDD:275368 | 5/45 (11%) | ||
| C2H2 Zn finger | 415..435 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 428..451 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 443..463 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 455..479 | CDD:290200 | 10/25 (40%) | ||
| COG5048 | <467..620 | CDD:227381 | 30/85 (35%) | ||
| C2H2 Zn finger | 471..491 | CDD:275368 | 7/20 (35%) | ||
| zf-H2C2_2 | 484..508 | CDD:290200 | 11/26 (42%) | ||
| C2H2 Zn finger | 499..519 | CDD:275368 | 6/21 (29%) | ||
| C2H2 Zn finger | 525..545 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 555..572 | CDD:275368 | |||
| C2H2 Zn finger | 598..615 | CDD:275371 | |||
| vezf1b | NP_001073432.1 | C2H2 Zn finger | 93..113 | CDD:275368 | 11/22 (50%) |
| C2H2 Zn finger | 194..214 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 206..231 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 222..242 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 252..270 | CDD:275368 | 6/17 (35%) | ||
| C2H2 Zn finger | 281..303 | CDD:275368 | 6/21 (29%) | ||
| C2H2 Zn finger | 309..328 | CDD:275368 | 5/19 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24390 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||