DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(Hw) and znf367

DIOPT Version :9

Sequence 1:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_001017726.2 Gene:znf367 / 550421 ZFINID:ZDB-GENE-050417-231 Length:316 Species:Danio rerio


Alignment Length:285 Identity:69/285 - (24%)
Similarity:104/285 - (36%) Gaps:76/285 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 THTGEKPFDCD--LCDKKFSALVALKKHRR------YHTGEKPYS---CTVCNQAFAVKEVLNRH 487
            |.|...|.:.|  .|.:.....:...:.|.      .:.||...|   |.:||:.|..::.|..|
Zfish    75 TRTSSSPAEADPLSCPEHLKDGIRRGRPRADTVRELINEGENSTSRIRCNICNRVFPREKSLQAH 139

  Fly   488 MKRHTGERPHKCD--ECGKSFIQATQLRTHSKTHI--RPFPCEQ--CDEKFKTEKQLERHVKTHS 546
            .:.||||||:.||  :|||:|:|:.||:||.:.|.  :||.|.:  |..:|       .|...|.
Zfish   140 KRTHTGERPYLCDYPDCGKAFVQSGQLKTHQRLHTGEKPFVCSEKACGSRF-------THANRHC 197

  Fly   547 RTKRPVFSCAECKRNFRTPALLKEHMDEGK---------HSPKQQRSSMRSAVKIMERTDCAICD 602
             .|.|.   |..||...|....|....:.|         ...::|||.:....|...::.     
Zfish   198 -AKHPY---ARLKREEPTGGPGKSQGADNKAVAEWLTKYWQTREQRSPVPGKAKPQNKSP----- 253

  Fly   603 KNFDSSDTLRRHIRTVHECDPDDIFGVEPHPSKRAKKDIESEEVVPVALNTSAGSLISSQTDGNG 667
                        :....:.||.|..     ||...:::.:.||              .|...|..
Zfish   254 ------------LEDQEQQDPLDFL-----PSDEGEEEEQEEE--------------KSAPSGGV 287

  Fly   668 VVVREFLVDEGD---GAAQTITLEN 689
            |..|..|.::.:   ||...|.|.|
Zfish   288 VTARRRLQEQRERLHGALALIELAN 312

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368
COG5048 <312..517 CDD:227381 32/95 (34%)
C2H2 Zn finger 321..341 CDD:275368
zf-C2H2 348..368 CDD:278523
C2H2 Zn finger 350..368 CDD:275368
C2H2 Zn finger 382..402 CDD:275368